Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060553.4 | Gene: | ZNF358 / 140467 | HGNCID: | 16838 | Length: | 568 | Species: | Homo sapiens |
Alignment Length: | 258 | Identity: | 83/258 - (32%) |
---|---|---|---|
Similarity: | 115/258 - (44%) | Gaps: | 46/258 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 FSCKRCDRTFRSKRDQTLHRQEVHNHNKTTYECKLCAKSFCNSGNLDRHMKVHNDVRPFVCNICS 80
Fly 81 KAFAQAVNLQRHYAVHSGE----------------------------RPFTCNFCNKSFTQQSNM 117
Fly 118 KRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIK 182
Fly 183 EGVDVDVP--------ASIQAAAALARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCHE 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 67/192 (35%) |
C2H2 Zn finger | 18..39 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 48..68 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 76..96 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 104..124 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
C2H2 Zn finger | 160..180 | CDD:275368 | 9/19 (47%) | ||
ZNF358 | NP_060553.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..117 | ||
COG5048 | <35..339 | CDD:227381 | 66/189 (35%) | ||
lambda-1 | 108..>174 | CDD:212564 | 9/23 (39%) | ||
zf-C2H2 | 151..173 | CDD:278523 | 9/22 (41%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 166..190 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 181..201 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 194..216 | CDD:290200 | 8/21 (38%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 222..244 | CDD:290200 | 6/21 (29%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 0/19 (0%) | ||
zf-H2C2_2 | 250..272 | CDD:290200 | 5/21 (24%) | ||
C2H2 Zn finger | 265..285 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 277..300 | CDD:290200 | 10/22 (45%) | ||
zf-C2H2_8 | 292..370 | CDD:292531 | 26/82 (32%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 305..328 | CDD:290200 | 8/22 (36%) | ||
C2H2 Zn finger | 321..341 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 333..356 | CDD:290200 | 6/27 (22%) | ||
C2H2 Zn finger | 349..369 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 361..384 | CDD:290200 | 6/24 (25%) | ||
zf-C2H2 | 375..397 | CDD:278523 | 5/22 (23%) | ||
C2H2 Zn finger | 377..397 | CDD:275368 | 5/20 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 448..568 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |