| Sequence 1: | NP_001286418.1 | Gene: | CG17385 / 36603 | FlyBaseID: | FBgn0033934 | Length: | 278 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001116097.1 | Gene: | zbtb26 / 100142649 | ZFINID: | ZDB-GENE-060526-122 | Length: | 412 | Species: | Danio rerio |
| Alignment Length: | 209 | Identity: | 64/209 - (30%) |
|---|---|---|---|
| Similarity: | 91/209 - (43%) | Gaps: | 39/209 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 MEVE-FDETVANQFSCKRCDRTFRSKRDQTLHRQEVHNH--NKTT--------------YECKLC 51
Fly 52 AKSFCNSGNL--------DRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYAVHSGERPFTCNFCN 108
Fly 109 KSFTQQSNMKRHKMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNF 173
Fly 174 KRHL-QSHIKEGVD 186 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17385 | NP_001286418.1 | COG5048 | <13..181 | CDD:227381 | 56/192 (29%) |
| C2H2 Zn finger | 18..39 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 48..68 | CDD:275368 | 5/27 (19%) | ||
| C2H2 Zn finger | 76..96 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 104..124 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 132..148 | CDD:275368 | 6/15 (40%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 8/20 (40%) | ||
| zbtb26 | NP_001116097.1 | BTB | 23..123 | CDD:279045 | |
| BTB | 34..127 | CDD:197585 | |||
| COG5048 | <193..>377 | CDD:227381 | 55/183 (30%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 316..338 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 318..338 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 333..355 | CDD:290200 | 11/21 (52%) | ||
| C2H2 Zn finger | 346..366 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 358..383 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 374..395 | CDD:275368 | 8/20 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005566 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||