powered by:
Protein Alignment CG10104 and YGL258W-A
DIOPT Version :9
Sequence 1: | NP_610961.1 |
Gene: | CG10104 / 36602 |
FlyBaseID: | FBgn0033933 |
Length: | 404 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_076890.1 |
Gene: | YGL258W-A / 852633 |
SGDID: | S000007607 |
Length: | 77 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 28/64 - (43%) |
Gaps: | 5/64 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 212 AMMEQGLLTKPI-FSVYLSRNGEK-DGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVI 273
|...||.:.|.| :|::| ||.. ..|:|.||..:...|..... .....:||..:..:|.:|
Yeast 2 AFERQGKIEKKISYSLFL--NGPNVHFGSILFGAVDKSKYAEELC-THPMRQAYNTLDSNSRII 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1339 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000066 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.