DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10104 and YPS5

DIOPT Version :9

Sequence 1:	NP_610961.1	Gene:	CG10104 / 36602	FlyBaseID:	FBgn0033933	Length:	404	Species:	Drosophila melanogaster
Sequence 2:	NP_011255.1	Gene:	YPS5 / 852632	SGDID:	S000003228	Length:	165	Species:	Saccharomyces cerevisiae

Alignment Length:	49	Identity:	18/49 - (36%)
Similarity:	27/49 - (55%)	Gaps:	2/49 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    69 NSAVKSTPLSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCA 117
            |..:.:|.::..  ..|...:.|||||||..:..|||||::.|.:|..|
Yeast    53 NEVLNTTVINGI--GVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIA 99

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10104	NP_610961.1	A1_Propeptide	28..54	CDD:285240
		pepsin_retropepsin_like	76..400	CDD:299705	16/42 (38%)
		Asp	84..402	CDD:278455	16/34 (47%)
YPS5	NP_011255.1	pepsin_retropepsin_like	65..>100	CDD:416259	16/35 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1339
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000066
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.900