DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and YPS3

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:79/352 - (22%)
Similarity:140/352 - (39%) Gaps:50/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YFGPITIGTPPQTFKVIFDTGSSNLWVP---SATCASTMVACRVHNRY-FAKRSTSHQVRGDHFA 145
            |...:.||||.|...|:.||||::||||   :..|.|.| .|..:..: ..|.||....:...|.
Yeast    63 YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVM-DCDQYGVFDKTKSSTFKANKSSPFY 126

  Fly   146 IHYGSGSLS-GFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSI-------- 201
            ..||.|:.: |....|.::...|::...:||.|.|.....       |:.|:...::        
Yeast   127 AAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVANESNSTF-------GVLGIGLSTLEVTYSGKV 184

  Fly   202 ------SMQRIKPPFYAMMEQGLLTKPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQV-- 258
                  |.:....|.: :...|.:....:|::|: :..:..|:|.||..:...|.|....:.:  
Yeast   185 AIMDKRSYEYDNFPLF-LKHSGAIDATAYSLFLN-DESQSSGSILFGAVDHSKYEGQLYTIPLVN 247

  Fly   259 -------SHRAYWQVKMDSAVI----RNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTP 312
                   .|...:.|.:....:    ||:.|.......::|:||:...||.....|:.:|:..:.
Yeast   248 LYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASY 312

  Fly   313 S-SFGQFLVPCDSVPDLPKITFTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLW 376
            | :.|.:...|.|..:...:.|..||.|......::..      :....:..:|: :|.......
Yeast   313 SKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTM------QTSVGTCVLAI-IPQAGNATA 370

  Fly   377 ILGDVFLGKYYTEFDMERHRIGFADAR 403
            ||||.||...|..:|::.:.|..|.|:
Yeast   371 ILGDSFLRNAYVVYDLDNYEISLAQAK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 77/347 (22%)
Asp 84..402 CDD:278455 78/349 (22%)
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 78/349 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.