DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and AT1G69100

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001320489.1 Gene:AT1G69100 / 843242 AraportID:AT1G69100 Length:375 Species:Arabidopsis thaliana


Alignment Length:345 Identity:115/345 - (33%)
Similarity:174/345 - (50%) Gaps:36/345 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRS-TSHQVR 140
            |.|:....::|.|::|:|||.|.|:|||||::|||||......  ....|.::....| |...::
plant    47 LKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDLWVPSKEWPEE--TDHKHPKFDKDASKTCRLMK 109

  Fly   141 GDHFAIHYGSGSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQR 205
            |....|.|.:||:.|.|:.|.|.|.|:.|:.|....|.. |...|.:.||||:.||..:|...|.
plant   110 GGEVNIAYETGSVVGILAQDNVNVGGVVIKSQDLFLARN-PDTYFRSVKFDGVIGLGIKSSRAQG 173

  Fly   206 IKPPFYAMMEQGLLTKPIFSVYL---SRNGEKD--GGAIFFGGSNPHYYTGNFTYVQVS-HRAYW 264
            ....:..|::|.|:||||||:||   ..:|.:|  ||.|.|||.:|..:.|...||.:. ....|
plant   174 SVTVWENMVKQKLITKPIFSLYLRPHKGDGGEDPNGGQIMFGGFDPKQFKGEHVYVPMKLSDDRW 238

  Fly   265 QVKMDSAVIRN---LELCQQ-GCEVIIDTGTSFLALPYDQAI-LINESIGGTPSSFGQFLVPCDS 324
            ::||....|..   :..|.. .|..::|:|::.:..| |:|: .|.:.||.|     :.::.|:.
plant   239 KIKMSKIYINGKPAINFCDDVECTAMVDSGSTDIFGP-DEAVGKIYKEIGAT-----KVIIRCEQ 297

  Fly   325 VPDLPKITFTLGGRRFFLESHEYVFRDIYQDR----RICSSAFIAVDLPSPSGPLWILGDVFLGK 385
            .|.||.|.|.:||:...|..|:||.......:    ||..|.....|        |:||:.|:.|
plant   298 FPALPDIYFEIGGKHLRLTKHDYVEVKTNPKKRCRLRIVKSKNRRKD--------WVLGEAFMTK 354

  Fly   386 YYTEF---DMERHRIGFADA 402
            ::|.|   |::..|||||:|
plant   355 FHTVFDYGDVKTPRIGFAEA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 112/341 (33%)
Asp 84..402 CDD:278455 112/336 (33%)
AT1G69100NP_001320489.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.