DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and REN

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens


Alignment Length:378 Identity:151/378 - (39%)
Similarity:231/378 - (61%) Gaps:8/378 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RVPLRRFPSARHRFEKLGIRMDRLRLKYAEEVSHFRGEWNSAVKSTPLSNYLDAQYFGPITIGTP 94
            |:.|:|.||.|...::.|:.|.||..::::.:.  |....:...|..|:||:|.||:|.|.||||
Human    33 RIFLKRMPSIRESLKERGVDMARLGPEWSQPMK--RLTLGNTTSSVILTNYMDTQYYGEIGIGTP 95

  Fly    95 PQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYGSGSLSGFLST 159
            ||||||:|||||||:||||:.|:....||..|..:.|..|:|::..|....:.|.:|::|||||.
Human    96 PQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQ 160

  Fly   160 DTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPPFYAMMEQGLLTKPIF 224
            |.:.|.|:.: .|.|.|.||||...|:.|:|||:.|:.:...::.|:.|.|..::.||:|.:.:|
Human   161 DIITVGGITV-TQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVF 224

  Fly   225 SVYLSRNGEKD---GGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDS-AVIRNLELCQQGCEV 285
            |.|.:|:.|..   ||.|..|||:|.:|.|||.|:.:.....||::|.. :|..:..||:.||..
Human   225 SFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLA 289

  Fly   286 IIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLGGRRFFLESHEYVFR 350
            ::|||.|:::........:.|::|.....| .::|.|:..|.||.|:|.|||:.:.|.|.:|||:
Human   290 LVDTGASYISGSTSSIEKLMEALGAKKRLF-DYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQ 353

  Fly   351 DIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFADAR 403
            :.|..:::|:.|..|:|:|.|:||.|.||..|:.|:|||||...:|||||.||
Human   354 ESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 9/23 (39%)
pepsin_retropepsin_like 76..400 CDD:299705 135/327 (41%)
Asp 84..402 CDD:278455 133/321 (41%)
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771 6/17 (35%)
renin_like 78..405 CDD:133154 137/328 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20151
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120302
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.