DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and Pga5

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:380 Identity:153/380 - (40%)
Similarity:209/380 - (55%) Gaps:14/380 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LYRVPLRRFPSARHRFEKLGIRMDRLRLKYAEEVSHFRGEW--NSAVKSTPLSNYLDAQYFGPIT 90
            |.::||.:..|.|....:..:..|.|. ||....:|...|.  |.||...|:.||||..|.|.|:
Mouse    16 LVKIPLMKIKSMRENLRESQVLKDYLE-KYPRSRAHVLLEQRRNPAVTYEPMRNYLDLVYIGIIS 79

  Fly    91 IGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYGSGSLSG 155
            ||||||.|:|:.|||||.|||||..|:|.  ||..|..:...||::..|.|....:.||||.:||
Mouse    80 IGTPPQEFRVVLDTGSSVLWVPSIYCSSP--ACAHHKAFNPLRSSTFLVSGRPVNVAYGSGEMSG 142

  Fly   156 FLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPPFYAMMEQGLLT 220
            ||:.||||:..|.:..|.|..:.|.||.....|.||||.||.|.::.:|.|.|.|..:..|||:.
Mouse   143 FLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQGITPVFDNLWLQGLIP 207

  Fly   221 KPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVIRNLEL--CQQGC 283
            :.:|:.|||...|| |..:..||.:|.||.|...:|.||..:|||:.:|| :..|.|:  |..||
Mouse   208 QNLFAFYLSSKDEK-GSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDS-ISMNGEVIACDGGC 270

  Fly   284 EVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLGGRRFFLESHEYV 348
            :.|:|||||.|..|....:.|...||...|..|::.:.||::..||.|.||:|...:.:.:..|:
Mouse   271 QGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIGSVTYPVPASAYI 335

  Fly   349 FRDIYQDRRICSSAFIAVDLPSPSGP-LWILGDVFLGKYYTEFDMERHRIGFADA 402
            .:|...:   |.|.| ...:..||.| :|:||||||..|:|.||...:|||.|.|
Mouse   336 RKDRSHN---CRSNF-EEGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIGLAPA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 6/25 (24%)
pepsin_retropepsin_like 76..400 CDD:299705 137/326 (42%)
Asp 84..402 CDD:278455 133/320 (42%)
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 7/28 (25%)
pepsin_retropepsin_like 64..385 CDD:299705 137/328 (42%)
Asp 74..386 CDD:278455 133/319 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.