DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and Bace2

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_062390.3 Gene:Bace2 / 56175 MGIID:1860440 Length:514 Species:Mus musculus


Alignment Length:481 Identity:113/481 - (23%)
Similarity:183/481 - (38%) Gaps:153/481 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLL---VSLLPVLFILPVQF----QHPVSCKLQLYRVPLRRFPSARHRFEKLGIRMDRLR--LKY 57
            |||   .:|.|..|.||:|.    .|..|.      ||....|.. .|.:.|.:.::.:|  ..:
Mouse    16 WLLSAVPALAPAPFTLPLQVARATNHRASA------VPGLGTPEL-PRADGLALALEPVRATANF 73

  Fly    58 AEEVSHFRGEWNSAVKSTPLSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVA 122
            ...|.:.:|:....             |:..:.||||||..:::.||||||..|..|.       
Mouse    74 LAMVDNLQGDSGRG-------------YYLEMLIGTPPQKVQILVDTGSSNFAVAGAP------- 118

  Fly   123 CRVH---NRYF-AKRSTSHQVRGDHFAIHYGSGSLSGFLSTDTVRV-----AGLEIRDQTFAEAT 178
               |   :.|| ::.|:::..:|....:.|..||.:||:..|.|.:     :...:...|..|:.
Mouse   119 ---HSYIDTYFDSESSSTYHSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVNIATIFESE 180

  Fly   179 E--MPGPIFLAAKFDGIFGLAYRSISMQRIKPP------FYAMMEQGLLTKPIFSVYLSRNG--- 232
            .  :||     .|::||.||||.:::    ||.      |.:::.|..: ..|||:.:...|   
Mouse   181 NFFLPG-----IKWNGILGLAYAALA----KPSSSLETFFDSLVAQAKI-PDIFSMQMCGAGLPV 235

  Fly   233 ---EKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVI--RNLEL-CQQ--GCEVIIDT 289
               ..:||::..||..|..|.|:..|..:....|:|:::....|  :||.| |::  ..:.|:|:
Mouse   236 AGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQNLNLDCREYNADKAIVDS 300

  Fly   290 GTSFLALP---YDQAI-------LINESIGG--------------TPSSFGQFLVPCDSVPDLPK 330
            ||:.|.||   :|..:       ||.|...|              ||.::            .||
Mouse   301 GTTLLRLPQKVFDAVVEAVARTSLIPEFSDGFWTGAQLACWTNSETPWAY------------FPK 353

  Fly   331 ITFTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLP---------------------SPSGP 374
            |:                   ||......|.:|....||                     |.|..
Mouse   354 IS-------------------IYLRDENASRSFRITILPQLYIQPMMGAGFNYECYRFGISSSTN 399

  Fly   375 LWILGDVFLGKYYTEFDMERHRIGFA 400
            ..::|...:..:|..||..:.|:|||
Mouse   400 ALVIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 5/25 (20%)
pepsin_retropepsin_like 76..400 CDD:299705 92/396 (23%)
Asp 84..402 CDD:278455 94/390 (24%)
Bace2NP_062390.3 beta_secretase_like 85..446 CDD:133140 94/405 (23%)
Asp 88..425 CDD:278455 92/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.