DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and PGC

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_002621.1 Gene:PGC / 5225 HGNCID:8890 Length:388 Species:Homo sapiens


Alignment Length:405 Identity:154/405 - (38%)
Similarity:229/405 - (56%) Gaps:24/405 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WLLVSLLPVLFILPVQFQHPVSCKLQLYRVPLRRFPSARHRFEKLGIRMDRLRL-KYAEEVSHFR 65
            |::|.|:.:..:           :..:.:|||::|.|.|...::.|:..:.||. ||.....:..
Human     3 WMVVVLVCLQLL-----------EAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRF 56

  Fly    66 GEWNSAVKSTPLSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYF 130
            |:  .:|...|:: |:||.|||.|:||||||.|.|:||||||||||||..|.|.  ||..|:|:.
Human    57 GD--LSVTYEPMA-YMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQ--ACTSHSRFN 116

  Fly   131 AKRSTSHQVRGDHFAIHYGSGSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFG 195
            ...|:::...|..|::.||||||:||...||:.|..:::.:|.|..:...||..|:.|:||||.|
Human   117 PSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMG 181

  Fly   196 LAYRSISMQRIKPPFYAMMEQGLLTKPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQVSH 260
            |||.::|:.........|:::|.||.|:||||||......|||:.|||.:...|||...:..|:.
Human   182 LAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQ 246

  Fly   261 RAYWQVKMDSAVI--RNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCD 323
            ..|||:.::..:|  :....|.:||:.|:|||||.|.:|......:.::.|.....:|||||.|:
Human   247 ELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQEDEYGQFLVNCN 311

  Fly   324 SVPDLPKITFTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSG-PLWILGDVFLGKYY 387
            |:.:||.:||.:.|..|.|....|    |..:...|:.......|.|.:| ||||||||||..||
Human   312 SIQNLPSLTFIINGVEFPLPPSSY----ILSNNGYCTVGVEPTYLSSQNGQPLWILGDVFLRSYY 372

  Fly   388 TEFDMERHRIGFADA 402
            :.:|:..:|:|||.|
Human   373 SVYDLGNNRVGFATA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 7/25 (28%)
pepsin_retropepsin_like 76..400 CDD:299705 135/326 (41%)
Asp 84..402 CDD:278455 133/320 (42%)
PGCNP_002621.1 A1_Propeptide 18..46 CDD:285240 9/27 (33%)
gastricsin 70..387 CDD:133144 135/322 (42%)
Asp 72..387 CDD:278455 133/320 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.