DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and pga4

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:381 Identity:154/381 - (40%)
Similarity:226/381 - (59%) Gaps:27/381 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RVPLRRFPSARHRFEKLGIRMDRLRLKYAEEVSHFRGEWNSAVKSTP---------LSNYLDAQY 85
            :||||:..|.|:|.::||:..|.|: ||         .:|.|.|..|         |.||:|.:|
 Frog    18 KVPLRKGESFRNRLQRLGLLGDYLK-KY
---------PYNPASKYFPTLAQSSAEVLQNYMDIEY 72

  Fly    86 FGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYGS 150
            :|.|:||||||.|.|||||||:||||||..|:|:  ||..|||:..::||:.|......:|.||:
 Frog    73 YGTISIGTPPQEFTVIFDTGSANLWVPSVYCSSS--ACTNHNRFNPQQSTTFQATNTPVSIQYGT 135

  Fly   151 GSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPPFYAMME 215
            ||:||||..||::|..::|.:|.|..:...||.....:.||||.|||:.||:..:..|.|..|..
 Frog   136 GSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSPFDGILGLAFPSIASSQATPVFDNMWS 200

  Fly   216 QGLLTKPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVIRNLEL-C 279
            |||:.:.:||||||.:|: .|..:.|||.:..||:|:..:|.::...|||:.:||..|....: |
 Frog   201 QGLIPQNLFSVYLSSDGQ-SGSYVLFGGVDTSYYSGSLNWVPLTAETYWQIILDSISINGQVIAC 264

  Fly   280 QQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLGGRRFFLES 344
            .|.|:.|:|||||.:..|......|...||.:..|.||:::.|:::.::|.|.||:.|.::.|..
 Frog   265 SQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNNISNMPTIVFTINGVQYPLPP 329

  Fly   345 HEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFA 400
            ..||    .|:::.|||.|.|:.||:.||.||||||||:.:|:..||...:.:..|
 Frog   330 TAYV----RQNQQGCSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFDRTNNYVAMA 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 10/23 (43%)
pepsin_retropepsin_like 76..400 CDD:299705 137/333 (41%)
Asp 84..402 CDD:278455 133/318 (42%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 11/26 (42%)
pepsin_A 62..382 CDD:133145 137/327 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.