DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and CG5860

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_650622.1 Gene:CG5860 / 42095 FlyBaseID:FBgn0038506 Length:370 Species:Drosophila melanogaster


Alignment Length:327 Identity:116/327 - (35%)
Similarity:172/327 - (52%) Gaps:12/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRG 141
            |..:.:.:|:|.|.:|.|.|.|.|||||||||.|:||..|..:..||:.|.:|.:.||:|:...|
  Fly    56 LQTHNNMEYYGTIAMGNPRQNFTVIFDTGSSNTWLPSVNCPMSNSACQNHRKYNSSRSSSYIPDG 120

  Fly   142 DHFAIHYGSGSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRI 206
            .:|.:.||||.:.|:||.||:.:||.|:...||.|:..:....|.:.||||:.||....:|....
  Fly   121 RNFTLRYGSGMVVGYLSKDTMHIAGAELPHFTFGESLFLQHFAFSSVKFDGLVGLGLGVLSWSNT 185

  Fly   207 KPPFYAMMEQGLLTKPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSA 271
            .|....:..|.||.|.:|||||.|    |...|.|||.:...:.|...||.||....|.:::..:
  Fly   186 TPFLELLCAQRLLEKCVFSVYLRR----DPREIVFGGFDESKFEGKLHYVPVSQWHTWSLQISKS 246

  Fly   272 VIRNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLG 336
            .:...::..:. ..|:|||||.:.:|......:..::.....: |.|:|.|.| ..||.|...:|
  Fly   247 SVGTKQIGGKS-NAILDTGTSLVLVPQQTYHNLLNTLSAKLQN-GYFVVACKS-GSLPNINILIG 308

  Fly   337 GRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFAD 401
            .:.|.|.|.:|:. ::..||:   .|.:....|...| .|:|||:||.:|||.||....|||.|.
  Fly   309 DKVFPLTSSDYIM-EVLLDRK---PACVLAIAPINRG-FWVLGDIFLRRYYTVFDATEKRIGLAK 368

  Fly   402 AR 403
            |:
  Fly   369 AK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 114/322 (35%)
Asp 84..402 CDD:278455 114/317 (36%)
CG5860NP_650622.1 pepsin_retropepsin_like 61..368 CDD:299705 113/318 (36%)
Asp 63..369 CDD:278455 114/317 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439947
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.