DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and CG31661

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster


Alignment Length:395 Identity:136/395 - (34%)
Similarity:210/395 - (53%) Gaps:41/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLYRVPLRRFPSARHRFEKLGIRM---DRLRLKY---------AEEVSHFRGEWNSAVKSTPLSN 79
            :::|..|.|.....|:.....:.:   :.||.||         |..|:...|:  ..|.:.||.|
  Fly    20 KVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVTSESGK--GVVITEPLIN 82

  Fly    80 YLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAK-RSTSHQVRGDH 143
            ..|..:||.:::|  .|:|.:.||||||:.||||:.|...:..|  .|::|.| .|.|.:..|..
  Fly    83 SYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTC--GNKFFRKSNSKSFRSSGTP 143

  Fly   144 FAIHYGSGSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLA---AKFDGIFGLAYRSISMQR 205
            |:|.|||||:.|.:::|.|....|:|::|..       |.:.::   :.||||.|.|::.:||.:
  Fly   144 FSITYGSGSVKGIVASDNVGFGDLKIQNQGI-------GLVNISDSCSVFDGIAGFAFQQLSMTK 201

  Fly   206 IKPPFYAMMEQGLLTKPIFSVYLSRNGEKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDS 270
            ..|.|..|::|.|:.:||||.:| ::|..|||::..||||...|.|..||..|:...||..|:|.
  Fly   202 SVPSFQQMIDQQLVEQPIFSFHL-KSGSSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDF 265

  Fly   271 AVI--RNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTPS-SFGQFLVPCDSVPDLPKIT 332
            ..:  :.....:.|.:.|:|||||.:..|..:.:.||:.||...: ::..:.|.|:|:|.||.|.
  Fly   266 IAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIV 330

  Fly   333 FTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRI 397
            |.:.|:.||::.|.||.|  |.:  .|.|||  :|:....  .|||||.|:.:.|.|||..|.|:
  Fly   331 FGIAGKEFFVKPHTYVIR--YDN--FCFSAF--MDMLGLQ--YWILGDAFMRENYVEFDWARRRM 387

  Fly   398 GFADA 402
            |.|.|
  Fly   388 GIAPA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 4/28 (14%)
pepsin_retropepsin_like 76..400 CDD:299705 122/330 (37%)
Asp 84..402 CDD:278455 119/324 (37%)
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 122/332 (37%)
Asp 88..392 CDD:278455 119/323 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439935
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.