DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and BACE1

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens


Alignment Length:455 Identity:114/455 - (25%)
Similarity:185/455 - (40%) Gaps:103/455 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWLLVSLLPVLFILPVQFQHPVSCKLQLYRVPLRRFPSARHRFEKLGIRMDR----------LRL 55
            :|:...:||.     ...||.:       |:|||.....    ..||:|:.|          .|.
Human    10 LWMGAGVLPA-----HGTQHGI-------RLPLRSGLGG----APLGLRLPRETDEEPEEPGRRG 58

  Fly    56 KYAEEVSHFRGEWNSAVKSTPLSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTM 120
            .:.|.|.:.||:....             |:..:|:|:||||..::.||||||..|.:|.     
Human    59 SFVEMVDNLRGKSGQG-------------YYVEMTVGSPPQTLNILVDTGSSNFAVGAAP----- 105

  Fly   121 VACRVH---NRYFAKR--STSHQVRGDHFAIHYGSGSLSGFLSTDTVRV---AGLEIRDQTFAEA 177
                 |   :||:.::  ||...:|...: :.|..|...|.|.||.|.:   ..:.:| ...|..
Human   106 -----HPFLHRYYQRQLSSTYRDLRKGVY-VPYTQGKWEGELGTDLVSIPHGPNVTVR-ANIAAI 163

  Fly   178 TEMPGPIFLAAKFDGIFGLAYRSISM--QRIKPPFYAMMEQGLLTKPIFSVYLSRNG-------- 232
            ||........:.::||.||||..|:.  ..::|.|.::::|..:.. :||:.|...|        
Human   164 TESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEV 227

  Fly   233 -EKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVIRNLELCQQGC------EVIIDTG 290
             ...||::..||.:...|||:..|..:....|::|.:....|...:| :..|      :.|:|:|
Human   228 LASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDL-KMDCKEYNYDKSIVDSG 291

  Fly   291 TSFLALP---YDQAILINESIGGT---PSSF--GQFLV--PCDSVP--DLPKITFTLGGR----- 338
            |:.|.||   ::.|:...::...|   |..|  |:.||  ...:.|  ..|.|:..|.|.     
Human   292 TTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQS 356

  Fly   339 -RFFLESHEYV--FRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFA 400
             |..:...:|:  ..|:...:..|....|     |.|....::|.|.:..:|..||..|.|||||
Human   357 FRITILPQQYLRPVEDVATSQDDCYKFAI-----SQSSTGTVMGAVIMEGFYVVFDRARKRIGFA 416

  Fly   401  400
            Human   417  416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 8/35 (23%)
pepsin_retropepsin_like 76..400 CDD:299705 94/368 (26%)
Asp 84..402 CDD:278455 96/362 (27%)
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58 4/18 (22%)
beta_secretase_like 72..437 CDD:133140 96/377 (25%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.