DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and asp-7

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_503826.2 Gene:asp-7 / 186613 WormBaseID:WBGene00019104 Length:380 Species:Caenorhabditis elegans


Alignment Length:413 Identity:109/413 - (26%)
Similarity:180/413 - (43%) Gaps:81/413 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSCKLQLYRVPLRRFPSARHRFEKLGIRMDRLRLKYAEEVSHFRGEWNSAVKSTPLSNYLDAQYF 86
            |.|....:.:.|.:....|.:..:.|..:.||:              ..:..:..:.::.|..|.
 Worm    13 VFCSAGQFSISLEKSVPLREQLIREGRELARLQ--------------QLSTGNESIYDHFDEYYT 63

  Fly    87 GPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHN-RYFAKRSTSHQVRG-DHFAIHYG 149
            ..:.||||.|.|:|..||.||||||....|.|.  :|:.|. |.:.:.::|..:.| .:|.:.:.
 Worm    64 VSVRIGTPAQHFEVALDTTSSNLWVFGVECKSQ--SCQGHRIREYNRTASSTFIAGTSNFVLPFN 126

  Fly   150 SGSLSGFLSTDTVRVAGLEIRDQTF---AEATEMPGPIFLAAKFDGIFGLAY-------RSISMQ 204
            .|.:||.|..|.::.||.:|::|.|   .:||.:.|     ..|||:.||.:       .|.:||
 Worm   127 DGDVSGDLGKDNIQFAGSKIQNQDFGIGTDATRLSG-----VTFDGVLGLGWPATALNGTSTTMQ 186

  Fly   205 RIKPPFYAMMEQGLLTKPIFSVYLSRNGEKD---GGAIFFGGSNPHYYTGNFTYVQVSHRAYWQV 266
            .:.|.         |.:|:|:.|.:::...:   ||.|.||..:..:......||::::.:.|..
 Worm   187 NLLPQ---------LDQPLFTTYFTKSSVHNGTVGGEITFGAIDTTHCQSQINYVRLAYDSLWSY 242

  Fly   267 KMDSAVIRNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFG----QFLVPCDSVPD 327
            .:|.....|... .|....|.||.:|:..:|   .:::.|.:..|.:.:.    .:.:||.|...
 Worm   243 SIDGFSFGNYSR-NQTDTAIPDTTSSYTGVP---NLVLAEIVIATGAQYDWNHQAYTLPCSSTAT 303

  Fly   328 LPKITFTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLP-------------SPSGPLWILG 379
            ||.:.||:||..:.:.:.|||               :.::||             |||||||:.|
 Worm   304 LPDLVFTIGGNSYNVRAVEYV---------------VNLNLPNGQCALSLFGTFSSPSGPLWVFG 353

  Fly   380 DVFLGKYYTEFDMERHRIGFADA 402
            |.||..|...||....|||.|.|
 Worm   354 DNFLRSYCHIFDFGNSRIGLAKA 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 4/25 (16%)
pepsin_retropepsin_like 76..400 CDD:299705 100/355 (28%)
Asp 84..402 CDD:278455 100/349 (29%)
asp-7NP_503826.2 Asp 60..376 CDD:365818 100/350 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162024
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1181
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.