DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and asp-3

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_509142.2 Gene:asp-3 / 180947 WormBaseID:WBGene00000216 Length:398 Species:Caenorhabditis elegans


Alignment Length:386 Identity:152/386 - (39%)
Similarity:221/386 - (57%) Gaps:16/386 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LYRVPLRRFPSARHRFEKLGIRMDRLRLKYAEEVSHFRGEWNSAVKSTPLSNYLDAQYFGPITIG 92
            :.|:.|.:....|.:: |.|...:.|:.||.......:..:|..     ||:|.:|||:||:|||
 Worm    18 IQRIKLEKRTYTREQY-KFGSIQEHLKAKYVPGYIPNKDAFNEG-----LSDYSNAQYYGPVTIG 76

  Fly    93 TPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYGSGSLSGFL 157
            ||||.|:|:|||||||||||.|.|....:|||:|||:..|:|:|....|..|.|.||:||:.|.:
 Worm    77 TPPQNFQVLFDTGSSNLWVPCANCPFGDIACRMHNRFDCKKSSSCTATGASFEIQYGTGSMKGTV 141

  Fly   158 STDTVRVAGLEI-----RDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPPFYAMMEQG 217
            ..|.| ..|.:.     ::|..|.||..||..|:|||||||||:.:.:||:.:|..|...:....
 Worm   142 DNDVV-CFGHDTTYCTDKNQGLACATSEPGITFVAAKFDGIFGMGWDTISVNKISQPMDQIFANS 205

  Fly   218 LLTK-PIFSVYLSR--NGEKDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVIRNLELC 279
            .:.| .:|:.:|||  |...:||.|....::|::|.||..:..:....||::|:.|.||......
 Worm   206 AICKNQLFAFWLSRDANDITNGGEITLCDTDPNHYVGNIAWEPLVSEDYWRIKLASVVIDGTTYT 270

  Fly   280 QQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLGGRRFFLES 344
            ....:.|:|||||.|..|.|....|...|||.|...|::.|.|..:|.||.|||.|||:.|.|:.
 Worm   271 SGPIDSIVDTGTSLLTGPTDVIKKIQHKIGGIPLFNGEYEVECSKIPSLPNITFNLGGQNFDLQG 335

  Fly   345 HEYVFR-DIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFADARS 404
            .:|:.: ........|.|.|:.:|:|:|:||||||||||:|::|:.||....|:|||.:|:
 Worm   336 KDYILQMSNGNGGSTCLSGFMGMDIPAPAGPLWILGDVFIGRFYSVFDHGNKRVGFATSRT 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 5/25 (20%)
pepsin_retropepsin_like 76..400 CDD:299705 140/332 (42%)
Asp 84..402 CDD:278455 138/326 (42%)
asp-3NP_509142.2 pepsin_retropepsin_like 59..393 CDD:299705 141/339 (42%)
Asp 68..393 CDD:278455 137/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.890

Return to query results.
Submit another query.