DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and asp-14

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_509082.2 Gene:asp-14 / 180917 WormBaseID:WBGene00019619 Length:366 Species:Caenorhabditis elegans


Alignment Length:333 Identity:84/333 - (25%)
Similarity:144/333 - (43%) Gaps:37/333 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYGSGSL 153
            :|:|||.|.|.|:.||.::::.:|..:| .|...|....|:...:|:|:...|:.:......|:.
 Worm    48 LTMGTPGQLFTVVIDTSTADIVIPDMSC-KTANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTF 111

  Fly   154 SGFLSTDTVRVAG-----LEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPPFYAM 213
            .||.:.|||.:..     :.|....|.:||:: |.:......|||.||.:.:.|......||...
 Worm   112 QGFDAKDTVVIGDRKTDLITIPGVKFMQATDL-GLLMDGLGADGILGLGFTASSQIGGNSPFVQG 175

  Fly   214 MEQGLLTKPIFSVYLSRNGEKDG----GAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDSAVIR 274
            :..|.::...:|::|....:.|.    |.|::||.:|.:...|.|||.::....:|:.|.|..:.
 Worm   176 VNAGDISGTFYSIWLEHFNQTDDLGTHGVIYYGGFDPVHCAPNPTYVPLASAYAYQLTMSSFKVV 240

  Fly   275 NLELCQQGCEVI---IDTGTSFLALPYDQAILINESIG---GTPSSFGQFLVPCDSVPDLPKITF 333
            .........:.|   :||.|:.:.||......:.:|:|   ...::....:|||::     |||.
 Worm   241 GSSATNSNNKYIQTYLDTTTAQIGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNT-----KITL 300

  Fly   334 TLG---GRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILG-DVFLGKYYTEFDMER 394
            |.|   |....:...:.|....    ..|....|      |:....||| .::.|: .|.||...
 Worm   301 TFGFVSGTTVSITERDLVISFF----GTCRLQII------PTTDRIILGLPLYRGR-CTYFDPIM 354

  Fly   395 HRIGFADA 402
            .|:||..|
 Worm   355 QRVGFTPA 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 82/329 (25%)
Asp 84..402 CDD:278455 83/331 (25%)
asp-14NP_509082.2 pepsin_like 44..361 CDD:133138 83/330 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.