DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and asp-13

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_505232.1 Gene:asp-13 / 179247 WormBaseID:WBGene00017881 Length:389 Species:Caenorhabditis elegans


Alignment Length:341 Identity:102/341 - (29%)
Similarity:170/341 - (49%) Gaps:26/341 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SAVKSTPLSNYLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRS 134
            :.|:||  ::|:..:|.|.||:|||.|.|.|:.||||:||.:|...|.:.....|:.|.   |.|
 Worm    59 TVVQST--TDYVYYEYMGNITVGTPDQNFIVVLDTGSANLLIPGTNCTTYCEKKRLFNE---KAS 118

  Fly   135 TSHQVRGDHFAIHYGSGSLSGFLSTDTVRVAG-----LEIRDQTFAEATEMPGPIFLAAKFDGIF 194
            :::......:.|.|.||...|.|..|||::.|     |.| .:::....:..|..|..:..:|||
 Worm   119 STYIATNRPWQIKYASGDAYGTLGIDTVKIGGSGEAQLAI-PRSYLGVADTVGSDFKWSPKEGIF 182

  Fly   195 GLAYRSISMQRIKPPFYAMMEQGLLTKPIFSVYLSRN---GEKDGGAIFFGGSNPHYYTGNFTYV 256
            |||:.::::..|.||....:.||||.:|:|:.:..:.   |....||..:||.:.::......|.
 Worm   183 GLAFTALAVDNITPPIINAINQGLLDQPLFTTWFGQRGAPGTSASGAFTYGGLDKNHCGPVIGYA 247

  Fly   257 QVSHRAYWQVKMDSAVIRNLELCQQGCEVIIDTGTSFLALPYDQAILIN--ESIGGTPSSFGQ-F 318
            ::::..::|.:.....:.:. :.....|||.||.||||..|  ||.:.|  ::.|.|.....| |
 Worm   248 ELTNARHFQFQATGFSLGSY-VSTTTYEVITDTATSFLCGP--QAAIDNLAKAAGATWDPTNQVF 309

  Fly   319 LVPCDSVPDLPKITFTLGGRRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFL 383
            .:|||:  |...|...:|...:.:.::.|:.:   .|...|..|.|..:. :..||.||||..|:
 Worm   310 NIPCDA--DAGPIKMKIGQFNYVIRANNYILK---IDTNSCLFAAIPQNY-AGFGPSWILGGPFM 368

  Fly   384 GKYYTEFDMERHRIGF 399
            .:|....|:.:.|:||
 Worm   369 RQYCNVHDIGQKRVGF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 99/335 (30%)
Asp 84..402 CDD:278455 98/327 (30%)
asp-13NP_505232.1 Asp 71..384 CDD:365818 96/325 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.