DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and KCTD11

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001350571.1 Gene:KCTD11 / 147040 HGNCID:21302 Length:271 Species:Homo sapiens


Alignment Length:99 Identity:23/99 - (23%)
Similarity:34/99 - (34%) Gaps:30/99 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLYRVPLRRFPSARHRFEKLGIRMD---------------RLRLKY-------AEEVSHFRGEWN 69
            :|.....||.|   |.:|...:::|               .||.::       ||...||..||.
Human   138 RLVHFSARRGP---HHYELSSVQVDTFRANLFCTDSECLGALRARFGVASGDRAEGSPHFHLEWA 199

  Fly    70 SAVKSTPLSNY--LDAQYFGPITIGTPPQTFKVI 101
            ......|...|  |..|   |:..|.|.:..:|:
Human   200 PRPVELPEVEYGRLGLQ---PLWTGGPGERREVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240 7/40 (18%)
pepsin_retropepsin_like 76..400 CDD:299705 8/28 (29%)
Asp 84..402 CDD:278455 5/18 (28%)
KCTD11NP_001350571.1 BTB 17..109 CDD:321966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1181
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.