DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and LOC101733630

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_012817292.3 Gene:LOC101733630 / 101733630 -ID:- Length:343 Species:Xenopus tropicalis


Alignment Length:326 Identity:157/326 - (48%)
Similarity:221/326 - (67%) Gaps:2/326 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 YLDAQYFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHF 144
            ||.|||:|.|.:|:|||.|.|:||||||||||||..|:...:||.:|::|.:.:|:::...|..|
 Frog    18 YLQAQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAF 82

  Fly   145 AIHYGSGSLSGFLSTDTVRVAGLEIRDQTFAEATEMPGPIFLAAKFDGIFGLAYRSISMQRIKPP 209
            ||.||:|||||:||.|||.:..|.::.|.|.||.:.||..|:|||||||.|:||..||:..:.|.
 Frog    83 AIQYGTGSLSGYLSKDTVTIGNLAVKGQMFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGVPPV 147

  Fly   210 FYAMMEQGLLTKPIFSVYLSRNGE-KDGGAIFFGGSNPHYYTGNFTYVQVSHRAYWQVKMDS-AV 272
            |..:|.|.|:...|||.||:||.: :.||.:..||::|.||||:|.|:.|:.:||||:.||. .|
 Frog   148 FDNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLNVTRKAYWQIHMDQLGV 212

  Fly   273 IRNLELCQQGCEVIIDTGTSFLALPYDQAILINESIGGTPSSFGQFLVPCDSVPDLPKITFTLGG 337
            ...|.||:.|||||:|||||.:..|.::...:.::||..|...||::|.||.||.||.|:.||||
 Frog   213 GDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGG 277

  Fly   338 RRFFLESHEYVFRDIYQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFADA 402
            :.:.|...:|:.:...:...||.|.|:.:::|.|:||||||||||:|:||:.||....|:|||.|
 Frog   278 QVYTLTGEQYIMKVSQRGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRAYDRVGFAKA 342

  Fly   403 R 403
            :
 Frog   343 K 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 154/321 (48%)
Asp 84..402 CDD:278455 153/319 (48%)
LOC101733630XP_012817292.3 Cathepsin_D2 18..341 CDD:133157 155/322 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X163
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.