DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10104 and bace2

DIOPT Version :9

Sequence 1:NP_610961.1 Gene:CG10104 / 36602 FlyBaseID:FBgn0033933 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001135590.1 Gene:bace2 / 100216145 XenbaseID:XB-GENE-1014090 Length:499 Species:Xenopus tropicalis


Alignment Length:373 Identity:95/373 - (25%)
Similarity:143/373 - (38%) Gaps:92/373 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 YFGPITIGTPPQTFKVIFDTGSSNLWVPSATCASTMVACRVHNRYFAKRSTSHQVRGDHFAIHYG 149
            |:..:.||||||...::.||||||..|..|....      :...:.:|.|||::.......:.|.
 Frog    75 YYLELLIGTPPQKMNILVDTGSSNFAVAGALNPD------ITTFFDSKLSTSYEPLNTQVTVRYT 133

  Fly   150 SGSLSGFLSTDTVRVAGLEIRDQTFAEATEMP-----------GPIFLAAKF-------DGIFGL 196
            .||.:|.|..|.:                .||           ..||.:..|       .||.||
 Frog   134 QGSWTGLLGKDVI----------------SMPKGVNGTFLINIASIFQSENFFLPNINWQGILGL 182

  Fly   197 AYRSISMQRIKP-----PFYAMMEQGLLTKPIFSVYLSRNGEK------DGGAIFFGGSNPHYYT 250
            ||.:::    ||     ||:..:.|......|||:.:...|:.      :.|::..||..|..|.
 Frog   183 AYSTLA----KPSSSVEPFFDSLVQQENIPNIFSMQMCGAGQPSPGIGINAGSLVLGGIEPSLYQ 243

  Fly   251 GNFTYVQVSHRAYWQVKMDSAVI--RNLELCQQGCEV------IIDTGTSFLALPYDQ------- 300
            |:..|..::...|:||::....:  :||.|   .|.|      |:|:||:.|.|| |:       
 Frog   244 GDIWYTPITEEWYYQVEVLKFEVGGQNLNL---DCTVYNSDKAIVDSGTTLLRLP-DKVFNAMVD 304

  Fly   301 AILINESIGGTPSSF--GQFLVPCDSVPD----LPKITF----TLGGRRFFLESHEYVFRD---I 352
            ||:....|....:.|  |..|...|...|    .|.|:.    |...|.|.|.....::..   .
 Frog   305 AIVQTSLIQNFNAEFWAGLQLACWDKTQDPWNYFPDISIYLRDTNSSRSFRLTLKPQLYIQSVLT 369

  Fly   353 YQDRRICSSAFIAVDLPSPSGPLWILGDVFLGKYYTEFDMERHRIGFA 400
            :|:...|....|     |.|....::|...:..:|..||....|:|||
 Frog   370 FQESLNCFRFGI-----SQSASALVIGATVMEGFYVIFDRAEKRVGFA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10104NP_610961.1 A1_Propeptide 28..54 CDD:285240
pepsin_retropepsin_like 76..400 CDD:299705 93/371 (25%)
Asp 84..402 CDD:278455 95/373 (25%)
bace2NP_001135590.1 beta_secretase_like 72..433 CDD:133140 95/373 (25%)
Asp 75..412 CDD:278455 93/371 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.