DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and GLP2R

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_011522379.1 Gene:GLP2R / 9340 HGNCID:4325 Length:578 Species:Homo sapiens


Alignment Length:444 Identity:123/444 - (27%)
Similarity:202/444 - (45%) Gaps:87/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CLTQFDSILCWPRTARGTLAVLQC----------MDELQG---------------IHYDSSKNAT 92
            |...||..:|||.::.|.::| .|          ..::||               ...:||..|.
Human    96 CNGTFDQYVCWPHSSPGNVSV-PCPSYLPWWSEDHQQIQGQLKLFSGKISGYKLQAKQESSGRAY 159

  Fly    93 RFCHANGTWEKYTNY-------DACAHLPA-PESVPEFEVIVELPTIIYYIGYTLSLVSLSLALI 149
            |.|.|.|||:...|.       ..|:...: .::|..:.::..| .::|.:||:.||:||.|||.
Human   160 RHCLAQGTWQTIENATDIWQDDSECSEN
HSFKQNVDRYALLSTL-QLMYTVGYSFSLISLFLALT 223

  Fly   150 VFAYFKELRCLRNTIHANLFFTYIMSALF---------------------WILLLSVQISIRSGV 193
            :..:.::|.|.||.||.|||.::|:..|.                     |:..||...:     
Human   224 LLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYSKRPDNENGWMSYLSEMST----- 283

  Fly   194 GSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAK 258
             ||.::..|.|:|...|:.|:|||||||:.|:..|...:...:..|..:||..|.||||.|..|:
Human   284 -SCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLWPRYLLLGWAFPVLFVVPWGFAR 347

  Fly   259 S---LTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTVET 320
            :   .|..::|....:|   |       ||.:||:...:.:|....|:|:.:||:||: |:.:..
Human   348 AHLENTGCWTTNGNKKI---W-------WIIRGPMMLCVTVNFFIFLKILKLLISKLK-AHQMCF 401

  Fly   321 RQYR-KAAKALLVLIPLFGITYLV--VLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNS 382
            |.|: :.||:.||||||.|:..::  .:......|....:...::..|.|..||.|:|.|.|.|.
Human   402 RDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFIQLTLSSFHGFLVALQYGFANG 466

  Fly   383 EVRNALRHH-----ISTWRDTRTIQLNQNRRY---TTKSFSKGGGSPRAESMRP 428
            ||:..||.:     ::.....|...|.::.|:   ..|..|:|.|:.:...::|
Human   467 EVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKKLSEGDGAEKLRKLQP 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 22/90 (24%)
7tmB1_DH_R 126..394 CDD:320391 92/299 (31%)
TM helix 1 129..153 CDD:320391 10/23 (43%)
TM helix 2 162..183 CDD:320391 9/41 (22%)
TM helix 3 197..219 CDD:320391 8/21 (38%)
TM helix 4 238..254 CDD:320391 8/15 (53%)
TM helix 5 279..302 CDD:320391 5/22 (23%)
TM helix 6 327..349 CDD:320391 9/23 (39%)
TM helix 7 356..381 CDD:320391 8/24 (33%)
GLP2RXP_011522379.1 HRM 93..187 CDD:280888 22/91 (24%)
7tm_2 200..457 CDD:278432 83/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.