DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and Sctr

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_038947043.1 Gene:Sctr / 81779 RGDID:621342 Length:464 Species:Rattus norvegicus


Alignment Length:394 Identity:122/394 - (30%)
Similarity:190/394 - (48%) Gaps:44/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SGHCLTQ-----FDSILCWPRTARGTLAVLQCMDELQGIHYDSSKNATRF--CHANGTWEKYTNY 107
            |.|.:.|     :|::.|||.:|......:||...|..:   |:||.:.|  |..:|..|.:...
  Rat    73 SSHAVYQGCEGLWDNMSCWPSSAPARTVEVQCPKFLLML---SNKNGSLFRNCTQDGWSETFPRP 134

  Fly   108 DACAHLPAPESVPE--FEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFF 170
            |....:....|..|  ...:::| .::|.:||:.||..|.:||.:...|:.|.|.||.||.:||.
  Rat   135 DLACGVNINNSFNERRHAYLLKL-KVMYTVGYSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFV 198

  Fly   171 TYIMSALF-----WILLLSVQISIRSG--VGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKT 228
            ::|:.||.     .:|..|..::....  || |..::..|.:..:.|:.|:|||||||:.|:..:
  Rat   199 SFILRALSNFIKDAVLFSSDDVTYCDAHKVG-CKLVMIFFQYCIMANYAWLLVEGLYLHTLLAIS 262

  Fly   229 FSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAV 293
            |..:......:..:|||.||:||..||:.:........   ::||.    ...|.|:.:|||...
  Rat   263 FFSERKYLQAFVLLGWGSPAIFVALWAITRHFLENTGC---WDINA----NASVWWVIRGPVILS 320

  Fly   294 LIINLTFLLRIMWVLITKLRSANT--VETRQYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGH 356
            ::||..|.:.|:.:|:.|||:..|  .||..|::.||:.|:|||||||.|:|....| |..:...
  Rat   321 ILINFIFFINILRILMRKLRTQETRGSETNHYKRLAKSTLLLIPLFGIHYIVFAFSP-EDAMEVQ 384

  Fly   357 MFAVLRAVLLSTQGFSVSLFYCFLNSEVRNALRHHISTWR----DTRTIQLNQNRRYTTKSFSKG 417
            :|..|  .|.|.||..|::.|||||.||:..::.....|.    ..|.:..|       .|||..
  Rat   385 LFFEL--ALGSFQGLVVAVLYCFLNGEVQLEVQKKWRQWHLQEFPLRPVAFN-------NSFSNA 440

  Fly   418 GGSP 421
            ...|
  Rat   441 TNGP 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 18/66 (27%)
7tmB1_DH_R 126..394 CDD:320391 94/276 (34%)
TM helix 1 129..153 CDD:320391 8/23 (35%)
TM helix 2 162..183 CDD:320391 9/25 (36%)
TM helix 3 197..219 CDD:320391 6/21 (29%)
TM helix 4 238..254 CDD:320391 7/15 (47%)
TM helix 5 279..302 CDD:320391 8/22 (36%)
TM helix 6 327..349 CDD:320391 12/21 (57%)
TM helix 7 356..381 CDD:320391 10/24 (42%)
SctrXP_038947043.1 HormR 80..147 CDD:214468 17/69 (25%)
7tmB1_secretin 154..420 CDD:320403 94/277 (34%)
TM helix 1 157..181 CDD:320403 9/24 (38%)
TM helix 2 190..211 CDD:320403 8/20 (40%)
TM helix 3 231..253 CDD:320403 6/21 (29%)
TM helix 4 272..288 CDD:320403 7/15 (47%)
TM helix 5 306..329 CDD:320403 8/22 (36%)
TM helix 6 356..378 CDD:320403 13/22 (59%)
TM helix 7 382..407 CDD:320403 10/26 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.