DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and PTH2R

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_005039.1 Gene:PTH2R / 5746 HGNCID:9609 Length:550 Species:Homo sapiens


Alignment Length:480 Identity:144/480 - (30%)
Similarity:234/480 - (48%) Gaps:71/480 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ELQCLVQEHIEASTYGNDSGHCLTQFDSILCWPRTARGTLAVLQCMDELQGIHYDSSKN--ATRF 94
            ::||  :.:|.|.....: |:|..::|.::||||...|.::.:.|...:    ||.:..  |.|.
Human    45 KVQC--ELNITAQLQEGE-GNCFPEWDGLICWPRGTVGKISAVPCPPYI----YDFNHKGVAFRH 102

  Fly    95 CHANGTWE-------KYTNYDACAHLPAPE-SVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVF 151
            |:.||||:       .:.||..|.....|: |:.:.|....| .::|.:||::|..||::|:::.
Human   103 CNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERL-YVMYTVGYSISFGSLAVAILII 166

  Fly   152 AYFKELRCLRNTIHANLFFTYIMSA--LF-----------------WILLLSVQISI------RS 191
            .||:.|.|.||.||.:||.::::.|  :|                 .|:....|.||      :|
Human   167 GYFRRLHCTRNYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSIEATSVDKS 231

  Fly   192 GVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAV 256
            ....|...:.:|.:|..||::|:|||||||:.|:...|..|......:..||||.||.||..|||
Human   232 QYIGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFILIGWGFPAAFVAAWAV 296

  Fly   257 AKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTV--E 319
            |::...        :..|..:....:.||||.|:.|.:.:|....|..:.||.||:...|.|  :
Human   297 ARATLA--------DARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHD 353

  Fly   320 TR-QYRKAAKALLVLIPLFGITYLVVLAGP-SESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNS 382
            || ||||.||:.|||:.:||:.|:|.:..| |.:||...:.........|.|||.||:.||:.|.
Human   354 TRKQYRKLAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYCNG 418

  Fly   383 EVRNALRHHISTWRDTRTIQLNQNRRYTTKSFSKGGGSPRAESMRPLTSYYGRGKRESCVSSATT 447
            ||:..::...|.|      .|:.:.:.|...     ||.|..|:  ||:.......:|.|:::|.
Human   419 EVQAEVKKMWSRW------NLSVDWKRTPPC-----GSRRCGSV--LTTVTHSTSSQSQVAASTR 470

  Fly   448 TTLV-GQHAPLSLHRGSNNALHTMP 471
            ..|: |:.|.::..:..::.  |:|
Human   471 MVLISGKAAKIASRQPDSHI--TLP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 20/68 (29%)
7tmB1_DH_R 126..394 CDD:320391 98/296 (33%)
TM helix 1 129..153 CDD:320391 7/23 (30%)
TM helix 2 162..183 CDD:320391 8/39 (21%)
TM helix 3 197..219 CDD:320391 8/21 (38%)
TM helix 4 238..254 CDD:320391 8/15 (53%)
TM helix 5 279..302 CDD:320391 7/22 (32%)
TM helix 6 327..349 CDD:320391 10/22 (45%)
TM helix 7 356..381 CDD:320391 8/24 (33%)
PTH2RNP_005039.1 HormR 60..125 CDD:214468 20/69 (29%)
7tmB1_PTH2R 141..430 CDD:320648 98/297 (33%)
TM helix 1 143..168 CDD:320648 8/25 (32%)
TM helix 2 177..199 CDD:320648 7/21 (33%)
TM helix 3 237..264 CDD:320648 12/26 (46%)
TM helix 4 276..296 CDD:320648 9/19 (47%)
TM helix 5 311..340 CDD:320648 8/28 (29%)
TM helix 6 357..384 CDD:320648 13/26 (50%)
TM helix 7 392..417 CDD:320648 8/24 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 511..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.