DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and gcgra

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_009298002.1 Gene:gcgra / 562973 ZFINID:ZDB-GENE-050516-1 Length:520 Species:Danio rerio


Alignment Length:459 Identity:126/459 - (27%)
Similarity:200/459 - (43%) Gaps:90/459 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CLTQFDSILCWPRTARGTLAVLQC-------MDELQG-IHYDSSKNATRFCHANGTWEKYTNYDA 109
            |...||...|||.....|...:.|       .:...| :|.:        |.|:|.:.|..:...
Zfish    54 CNRTFDRYACWPDALPNTTVSVACPWYLPWHKEVRHGLVHVE--------CDADGQYSKQKDASE 110

  Fly   110 CAHLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIM 174
            |.   :.:::..:..|:.....:|.:||:|||.:|.|||.:...|::|.|:||.||.|||.::|:
Zfish   111 CL---S
RDNIQHYGRILRQFRTMYTVGYSLSLGALVLALSILVAFRKLHCMRNNIHMNLFASFIL 172

  Fly   175 SALFWILLLSVQISIR-----------------------SGVGSCIALITLFHFFTLTNFFWMLV 216
            .|.  .:|:...:|.|                       :.|| |...:.:..:..|.|.:|:||
Zfish   173 RAS--SILIKDALSERPDTFPVGQDITTELEVEWLVKNETAVG-CRVAVVMMQYSILANSYWLLV 234

  Fly   217 EGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETH 281
            ||:||:.|:|.|...:....:||.|||||.|.:||:.|.:.|.|         ||....|.|..|
Zfish   235 EGIYLHSLLVVTVLTERNYLSIYLSIGWGAPLIFVLPWVIVKYL---------YENEECWEQNNH 290

  Fly   282 VD--WIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTVETRQYR-KAAKALLVLIPLFGITYLV 343
            ::  ||.:.|:...::||....:.|:.:|::||| |:.:....|: :.||:.|.||||.||..::
Zfish   291 MEYWWIIRSPILLAVLINFFIFIHIIKILVSKLR-AHQMRYSDYKFRLAKSTLTLIPLLGIHSVL 354

  Fly   344 VLAGPSESGLMGHMFAVLRAVLL-------STQGFSVSLFYCFLNSEVRNALRHHISTWRDTRTI 401
            ......||  ..|....||...|       |.||..|::.|||:|.||::.:......|:..|.|
Zfish   355 FSFVTDES--TSHGALPLRLTKLFIDLFFNSFQGLLVAILYCFVNKEVQSEILKKWRRWKLGRDI 417

  Fly   402 QLNQNRRYT-TKSFSKGG----------------------GSPRAESMRPLTSYYGRGKRESCVS 443
            :......|: :....|.|                      |||..:.|...:|..|.|..:.|:.
Zfish   418 EEEYRHTYSQSLQIQKSGSIMVHPTNLPRLPDIATTTSRLGSPEEKQMLVSSSQNGMGIGQGCLQ 482

  Fly   444 SATT 447
            ..:|
Zfish   483 FTST 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 15/66 (23%)
7tmB1_DH_R 126..394 CDD:320391 95/300 (32%)
TM helix 1 129..153 CDD:320391 10/23 (43%)
TM helix 2 162..183 CDD:320391 8/20 (40%)
TM helix 3 197..219 CDD:320391 6/21 (29%)
TM helix 4 238..254 CDD:320391 10/15 (67%)
TM helix 5 279..302 CDD:320391 6/24 (25%)
TM helix 6 327..349 CDD:320391 9/21 (43%)
TM helix 7 356..381 CDD:320391 11/31 (35%)
gcgraXP_009298002.1 HRM 51..113 CDD:308439 15/69 (22%)
7tm_GPCRs 124..410 CDD:333717 95/300 (32%)
TM helix 1 127..151 CDD:320095 10/23 (43%)
TM helix 2 160..181 CDD:320095 9/22 (41%)
TM helix 3 215..237 CDD:320095 6/21 (29%)
TM helix 4 256..272 CDD:320095 10/15 (67%)
TM helix 5 290..313 CDD:320095 6/22 (27%)
TM helix 6 335..360 CDD:320095 9/24 (38%)
TM helix 7 372..397 CDD:320095 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X66
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.