DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and NNMT

DIOPT Version :10

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_006160.1 Gene:NNMT / 4837 HGNCID:7861 Length:264 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:32/70 - (45%) Gaps:7/70 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 YLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVA--KSLTVT-YSTPEKYEINCPWMQE-- 279
            :|...:.|.|..|.::.::...|| .||.::.:..|..  |.:.|| ||.....|:. .|:::  
Human    40 HLLKNLFKIFCLDGVKGDLLIDIG-SGPTIYQLLSACESFKEIVVTDYSDQNLQELE-KWLKKEP 102

  Fly   280 THVDW 284
            ...||
Human   103 EAFDW 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086
7tmB1_DH_R 126..394 CDD:320391 18/70 (26%)
TM helix 1 128..153 CDD:320391
TM helix 2 162..184 CDD:320391
TM helix 3 197..224 CDD:320391 1/3 (33%)
TM helix 4 236..256 CDD:320391 4/19 (21%)
TM helix 5 279..308 CDD:320391 2/8 (25%)
TM helix 6 322..349 CDD:320391
TM helix 7 356..381 CDD:320391
NNMTNP_006160.1 NNMT_PNMT_TEMT 2..259 CDD:395988 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.