DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and mthl6

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_788473.1 Gene:mthl6 / 38839 FlyBaseID:FBgn0035789 Length:480 Species:Drosophila melanogaster


Alignment Length:479 Identity:102/479 - (21%)
Similarity:169/479 - (35%) Gaps:154/479 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DHNHIDSVNAS-GSDPLLDLHNLDGIGESVEL----QCLVQEHIEASTYGNDSGHCLTQFDSIL- 61
            |.:||..:|.| ..:.|:...:|.|:....:|    |..|:.|:.|         |:.:....: 
  Fly    32 DISHIPKLNDSYAYEELIIPAHLTGLYTFRQLADGSQEPVKSHLRA---------CICKLKPCIR 87

  Fly    62 -CWPRTAR---------------------------GTLAVLQCMDELQGIHYDSSKNATRFC--- 95
             |.||...                           ||:.....:.::..:.|:     .|:|   
  Fly    88 FCCPRNKMMPNSRCSDGLTENLKRINPYLKITLEDGTIGKYYLLTDMIVLRYE-----FRYCEKV 147

  Fly    96 ----------HANGT--------WEKYTNYDACAH--LPAPESVPEFEVIV---ELPTIIYYIGY 137
                      :.||:        |.....: .|.|  |..|.|:...|.:.   .:|. :..:| 
  Fly   148 VSVQEDQYKLYENGSFMIKPDVNWTLSKQW-YCLHPRLEDPNSIWILEHVYIPKSMPA-VPQVG- 209

  Fly   138 TLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSVQISIRSGVGSCIALITL 202
            |:|:|...|.:.|:.|.|:||.|.........|...:..|.|   ....:::.:.:.|...... 
  Fly   210 TISMVGCILTIAVYLYIKKLRNLLGKCFICYVFCKFVQYLIW---AGGDLNLWNNICSLAGYTN- 270

  Fly   203 FHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLR----------FNIYASIGWGGPAL-----FVV 252
             :||.|.:.||:.|....::         .|||          |.||...|||.||:     ::|
  Fly   271 -YFFALASHFWLSVMSHQIW---------KNLRLINRDERSYHFLIYNIYGWGTPAIMTAITYLV 325

  Fly   253 TWAVAKSLTVTYSTPEKYE-------INCPWMQETHVDW---IY-QGPVCAVLIIN-LTFLLRIM 305
            .||       ....|:|..       ..| |:..  .||   || .||:..:.:.| :||:|.:.
  Fly   326 DWA-------WEDRPDKLNWIPGVGLYRC-WINT--YDWSAMIYLYGPMLILSLFNVVTFILTVN 380

  Fly   306 WVLITKLRSANTVETRQYRKAAK--------ALLVLIPLFG----ITYLVVLAGPSESGLMGHMF 358
            .::  |::|:....|:|.||..:        .|.|::.:.|    |||.|          ..|.|
  Fly   381 HIM--KIKSSVKSSTQQQRKCIQNNDFLLYLRLSVMMGVTGISEVITYFV----------KRHKF 433

  Fly   359 --AVLRAVLLSTQGFSVSLFYCFL 380
              .|||.......|..:.:|..|:
  Fly   434 WRQVLRVPNFFHLGSGIVVFVLFI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 13/109 (12%)
7tmB1_DH_R 126..394 CDD:320391 71/299 (24%)
TM helix 1 129..153 CDD:320391 7/23 (30%)
TM helix 2 162..183 CDD:320391 3/20 (15%)
TM helix 3 197..219 CDD:320391 6/21 (29%)
TM helix 4 238..254 CDD:320391 8/20 (40%)
TM helix 5 279..302 CDD:320391 9/27 (33%)
TM helix 6 327..349 CDD:320391 7/33 (21%)
TM helix 7 356..381 CDD:320391 8/27 (30%)
mthl6NP_788473.1 Mth_Ecto 25..197 CDD:119403 31/179 (17%)
7tm_4 211..398 CDD:304433 51/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.