DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and mthl1

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster


Alignment Length:452 Identity:97/452 - (21%)
Similarity:151/452 - (33%) Gaps:112/452 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CWPRTAR-GTLAVLQCMDELQ-----GIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVP 120
            |...|.| |.:.::.|.....     ||| |.|...| ...|||.                    
  Fly   283 CLEHTQREGEVKIIACQHLFSSAAGAGIH-DGSIGGT-IEQANGQ-------------------- 325

  Fly   121 EFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSV 185
                  .|...:...|..:|:|.||..|:  |.|. |..:.:.:|......|:...||..:||::
  Fly   326 ------NLQKAVLTGGILVSIVFLSATLV--AGFL-LPAVHHALHWRCQICYVTCLLFGKILLAI 381

  Fly   186 Q---ISIRSGVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTF----------SGDNLRFN 237
            :   .|::.|..:|..|.....||.|..|||:......::.    ||          :.:.||..
  Fly   382 EELSSSLQPGSAACHTLAITMQFFFLAAFFWLNTMCFNIWW----TFRDFRPSSLERNQEALRRY 442

  Fly   238 IYASIGWGGPALFVVTWAVAKSL-TVTYSTPEKYEINCPWMQETHVDWI--YQGPVCAVLIINLT 299
            :|:...||||.|.....|....| ..|...|...::.| |....::...  :.||:..:|..|:.
  Fly   443 LYSLYAWGGPLLITFVAACVDQLPETTLLRPGFGQLYC-WFDNRNLSIFAYFYGPIGLLLCANIA 506

  Fly   300 FLLRIMWVLITKLRSANTVETRQYRKA-AKALLVLIPLFGITYLV-----VLAGPSESGLMGHMF 358
            ..:.....|...|...:.|::...:.| .:..|.|:.:.|:|::.     ::.||........:.
  Fly   507 LFVSTTHQLTCGLWKRDDVKSSSEKSALGRVCLKLVVVMGVTWIADILSWLVGGPHGVWFFTDLI 571

  Fly   359 AVLRAVLLSTQGFSV-----------SLFYCFLNSEVRNALRHHISTWRDTRTIQLNQNRRYTTK 412
            ..|:.|.:    |.|           ...:|       ..|||.|:.               ||.
  Fly   572 NALQGVFI----FIVVGCQPQVWTACRRIFC-------PRLRHDITN---------------TTN 610

  Fly   413 SFSKGGGSPRAESMRPLTSYYGRGKRESCVSSATTTTLVGQHAPLSLHRGSNNALHTMPTLA 474
            .......|....||        .|..|...::.||||.....|   .|..||.|...:|..|
  Fly   611 GVQHSSSSQGLPSM--------AGGTEITQNTTTTTTTTNTTA---THMPSNPAEDEVPEKA 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 14/55 (25%)
7tmB1_DH_R 126..394 CDD:320391 65/300 (22%)
TM helix 1 129..153 CDD:320391 6/23 (26%)
TM helix 2 162..183 CDD:320391 4/20 (20%)
TM helix 3 197..219 CDD:320391 7/21 (33%)
TM helix 4 238..254 CDD:320391 6/15 (40%)
TM helix 5 279..302 CDD:320391 4/24 (17%)
TM helix 6 327..349 CDD:320391 5/26 (19%)
TM helix 7 356..381 CDD:320391 5/35 (14%)
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 57/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.