DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and mthl14

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_728509.1 Gene:mthl14 / 318046 FlyBaseID:FBgn0052476 Length:533 Species:Drosophila melanogaster


Alignment Length:295 Identity:65/295 - (22%)
Similarity:102/295 - (34%) Gaps:95/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 AVL--QCMDELQ---GIHYD-----------SSKNATRFCHANGTW--------EKYT------- 105
            |||  .|:::|:   .:.||           ..|:...|...:|:.        |.||       
  Fly   153 AVLFDNCIEDLEVETTLDYDIGNPCNSSLLYDDKDDVFFVLQDGSLLIIDKFGNESYTVKEHYCL 217

  Fly   106 NYDACAHLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFF 170
            :.|...||.|...|.:.|..:....:::..  .|.|:|:...|:|......||.|||        
  Fly   218 DIDKSGHLFAFTCVTQVEEQIAFAKVVFVA--VLMLISMPCLLLVSYLHMTLRLLRN-------- 272

  Fly   171 TYIMSALFWILLLSVQISIRSG--VGSCIALITL---------FHFFTLTNFFW-------MLVE 217
                  |..:.|..:.:.:.||  |.|.:.:..:         ..|..|:.|||       :|:.
  Fly   273 ------LHGLSLSLMSLCLASGYFVHSVVHIYGIPNQGFIGYVIQFCILSYFFWYLCICFNVLLN 331

  Fly   218 GLY-LYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAK-----------SLTVTYSTPEKY 270
            ..| |...:..:.|.....|..||...:.|||. :|...|.|           .||.:....::|
  Fly   332 VWYKLPCCIQCSKSWATFNFACYAVFAFSGPAT-IVALTVQKGLPGMPSYFLQGLTESIRDSQRY 395

  Fly   271 EINCPWMQETHVDWIYQGPVCAVLIINLTFLLRIM 305
            .|               .||..:|.  |:|||.|:
  Fly   396 FI---------------PPVSTILF--LSFLLNII 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 14/70 (20%)
7tmB1_DH_R 126..394 CDD:320391 46/210 (22%)
TM helix 1 129..153 CDD:320391 5/23 (22%)
TM helix 2 162..183 CDD:320391 2/20 (10%)
TM helix 3 197..219 CDD:320391 6/37 (16%)
TM helix 4 238..254 CDD:320391 6/15 (40%)
TM helix 5 279..302 CDD:320391 5/22 (23%)
TM helix 6 327..349 CDD:320391
TM helix 7 356..381 CDD:320391
mthl14NP_728509.1 7tmB3_Methuselah-like 239..512 CDD:320167 46/209 (22%)
TM helix 1 241..266 CDD:320167 5/26 (19%)
TM helix 2 275..297 CDD:320167 5/21 (24%)
TM helix 3 306..331 CDD:320167 6/24 (25%)
TM helix 4 349..369 CDD:320167 7/20 (35%)
TM helix 5 389..418 CDD:320167 10/42 (24%)
TM helix 6 445..472 CDD:320167
TM helix 7 477..502 CDD:320167
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.