DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and CG15744

DIOPT Version :9

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_572870.2 Gene:CG15744 / 2768909 FlyBaseID:FBgn0030466 Length:1797 Species:Drosophila melanogaster


Alignment Length:514 Identity:99/514 - (19%)
Similarity:168/514 - (32%) Gaps:170/514 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QFDSILCWPRTARGTLAVLQC--------MDELQGIH-YDSSKNATRFCHANGTWEKYTNYDACA 111
            ::::.:|.......||.:..|        :...|.:: :.|.::..||.|               
  Fly   713 RWETSVCQQHYQHRTLVMFSCSRTGYYGLLQRSQYLNDFRSEESGARFRH--------------- 762

  Fly   112 HLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYF-KELRCLRNTIHANLFFTYIMS 175
                             |....|.|..|.....:...:.||.| :.:|..|...|| |..|    
  Fly   763 -----------------PPAAVYAGCGLLFACCAFNAVTFAVFGRAVRINRVQRHA-LVNT---- 805

  Fly   176 ALFWILLLSVQISIRSGV------GSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFS---- 230
               |:.|.::.::...|:      ..|..|..|.|:..|....|:.|....:|..:.||.:    
  Fly   806 ---WLALGALALAFSLGIYQTASQPQCRLLGLLMHYLGLCVLLWVCVSLSSMYKRLTKTTTSGQG 867

  Fly   231 ---GDNLR----------FNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHV 282
               |.::.          ..||. :|| |.||.:...:.|.:| ..|:|   |:. |.....|.:
  Fly   868 QCPGQDMEPQRERERKPILGIYL-VGW-GIALLICGISSAVNL-AEYAT---YDY-CFLHSSTTL 925

  Fly   283 DWIYQGPV-----CAVLIINLTFLLRIMWVLITKLRSANTVETRQY----RKAAKAL-LVLIPLF 337
            :.:....|     |.:|.:.:.:.|....|.:.:|:..:. :.|||    .:|.:.: |..:...
  Fly   926 NALLVPAVILVIFCGILALCIYYQLSQQAVNVLQLQMQHQ-QNRQYSDNNTQATEHIDLDWLDAN 989

  Fly   338 GITYLVVLAGPSE----------------------------------SGLMGH-MFAVLRA---- 363
            |......:.|.|.                                  |.|.|| :|.||.|    
  Fly   990 GSATTAAIGGGSGNHGGRKEQDHMQEQYSTLSNPLSSIVDDFERSNLSHLRGHFIFLVLYAGAWL 1054

  Fly   364 -------------VL-----LSTQGFSVSLFYCFLNSEVRNALRHHISTWRDTRTIQLNQNRRYT 410
                         ||     .|..|..:.:||....::.|.|.    |..||.|:|        .
  Fly  1055 SAAAYVNGGQELYVLSFAGCCSVLGIFLLIFYNLSRNDARQAW----SQGRDGRSI--------P 1107

  Fly   411 TKSFSKGGGSPRAESMRPLTSYYGRGKRESCVSSATTTTLVGQHA---PLSLHRGSNNA 466
            .|..:...|| :|....|.:...|.|      ::..:.::|...|   |.||:..:|:|
  Fly  1108 AKLVTYNNGS-QARGAHPSSMMPGPG------TAMISNSIVAYKANPGPGSLYEANNSA 1159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086 9/64 (14%)
7tmB1_DH_R 126..394 CDD:320391 71/358 (20%)
TM helix 1 129..153 CDD:320391 5/23 (22%)
TM helix 2 162..183 CDD:320391 5/20 (25%)
TM helix 3 197..219 CDD:320391 6/21 (29%)
TM helix 4 238..254 CDD:320391 7/15 (47%)
TM helix 5 279..302 CDD:320391 4/27 (15%)
TM helix 6 327..349 CDD:320391 3/22 (14%)
TM helix 7 356..381 CDD:320391 11/47 (23%)
CG15744NP_572870.2 LRR_8 107..168 CDD:290566
LRR_4 107..147 CDD:289563
leucine-rich repeat 109..133 CDD:275378
leucine-rich repeat 134..157 CDD:275378
LRRCT 166..216 CDD:214507
IG_like 229..344 CDD:214653
HRM <366..412 CDD:295297
7tm_4 768..>975 CDD:304433 49/222 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.