DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dh44-R1 and FBXO46

DIOPT Version :9

Sequence 1:	NP_610960.1	Gene:	Dh44-R1 / 36601	FlyBaseID:	FBgn0033932	Length:	504	Species:	Drosophila melanogaster
Sequence 2:	NP_001073938.1	Gene:	FBXO46 / 23403	HGNCID:	25069	Length:	603	Species:	Homo sapiens

Alignment Length:	89	Identity:	21/89 - (23%)
Similarity:	35/89 - (39%)	Gaps:	14/89 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   417 GGGSPRAESMRPLTSYYGRG-----KRESCVS-SATTTTLVGQHAPLSLHRGSNNALHTMPTLAA 475
            |||| ||.||: :..::|..     :|..|:. :.......|:..|.:...|..:|...:..|:.
Human   110 GGGS-RASSMK-VKGHWGSDSSKAKRRRRCLDPTKAPPDPGGREGPPAAEEGPASAGEDVDLLSV 172

  Fly   476 NAM------SSGSTLSVMPRAISP 493
            ..|      .:...|...||..:|
Human   173 AEMVALVEQRAALALQSYPRPTTP 196

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dh44-R1	NP_610960.1	HRM	52..112	CDD:397086
		7tmB1_DH_R	126..394	CDD:320391
		TM helix 1	129..153	CDD:320391
		TM helix 2	162..183	CDD:320391
		TM helix 3	197..219	CDD:320391
		TM helix 4	238..254	CDD:320391
		TM helix 5	279..302	CDD:320391
		TM helix 6	327..349	CDD:320391
		TM helix 7	356..381	CDD:320391
FBXO46	NP_001073938.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	20..63
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	111..163		13/53 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	235..301
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	326..360
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	396..440
		F-box-like	473..>507	CDD:289689
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4564
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900