DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dh44-R1 and Inmt

DIOPT Version :10

Sequence 1:NP_610960.1 Gene:Dh44-R1 / 36601 FlyBaseID:FBgn0033932 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_033375.1 Gene:Inmt / 21743 MGIID:102963 Length:264 Species:Mus musculus


Alignment Length:83 Identity:19/83 - (22%)
Similarity:35/83 - (42%) Gaps:19/83 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 FTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWA--VAKSLTVTYSTPE 268
            |:|.|.:              :|||...:..::...|| .||.::.:..|  |.:.:.||..||:
Mouse    41 FSLQNLY--------------QTFSTGGVGGDVLIDIG-SGPTIYQLLSACEVFREIIVTDYTPQ 90

  Fly   269 KYEINCPWMQET--HVDW 284
            ..:....|:::.  ..||
Mouse    91 NLQELQKWLKKEPGAYDW 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dh44-R1NP_610960.1 HRM 52..112 CDD:397086
7tmB1_DH_R 126..394 CDD:320391 19/83 (23%)
TM helix 1 128..153 CDD:320391
TM helix 2 162..184 CDD:320391
TM helix 3 197..224 CDD:320391 3/17 (18%)
TM helix 4 236..256 CDD:320391 5/21 (24%)
TM helix 5 279..308 CDD:320391 2/8 (25%)
TM helix 6 322..349 CDD:320391
TM helix 7 356..381 CDD:320391
InmtNP_033375.1 NNMT_PNMT_TEMT 1..260 CDD:395988 19/83 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.