powered by:
Protein Alignment Dh44-R1 and INMT
DIOPT Version :9
Sequence 1: | NP_610960.1 |
Gene: | Dh44-R1 / 36601 |
FlyBaseID: | FBgn0033932 |
Length: | 504 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_006765.4 |
Gene: | INMT / 11185 |
HGNCID: | 6069 |
Length: | 263 |
Species: | Homo sapiens |
Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
Similarity: | 25/62 - (40%) |
Gaps: | 5/62 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 227 KTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYS--TPEKYEINCPWMQET--HVDW 284
|||....|:.:....|| .||.::.|..|......:|.| |....|....|:::. ..||
Human 47 KTFGPGGLQGDTLIDIG-SGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDW 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4564 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.