DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dh44-R1 and INMT

DIOPT Version :9

Sequence 1:	NP_610960.1	Gene:	Dh44-R1 / 36601	FlyBaseID:	FBgn0033932	Length:	504	Species:	Drosophila melanogaster
Sequence 2:	NP_006765.4	Gene:	INMT / 11185	HGNCID:	6069	Length:	263	Species:	Homo sapiens

Alignment Length:	62	Identity:	17/62 - (27%)
Similarity:	25/62 - (40%)	Gaps:	5/62 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   227 KTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYS--TPEKYEINCPWMQET--HVDW 284
            |||....|:.:....|| .||.::.|..|......:|.|  |....|....|:::.  ..||
Human    47 KTFGPGGLQGDTLIDIG-SGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDW 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dh44-R1	NP_610960.1	HRM	52..112	CDD:397086
		7tmB1_DH_R	126..394	CDD:320391	17/62 (27%)
		TM helix 1	129..153	CDD:320391
		TM helix 2	162..183	CDD:320391
		TM helix 3	197..219	CDD:320391
		TM helix 4	238..254	CDD:320391	5/15 (33%)
		TM helix 5	279..302	CDD:320391	2/8 (25%)
		TM helix 6	327..349	CDD:320391
		TM helix 7	356..381	CDD:320391
INMT	NP_006765.4	NNMT_PNMT_TEMT	4..259	CDD:250464	17/62 (27%)
		S-adenosyl-L-methionine binding	85..87		0/1 (0%)
		S-adenosyl-L-methionine binding	142..143
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4564
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900