DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50e and Obp49a

DIOPT Version :9

Sequence 1:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_610812.1 Gene:Obp49a / 36399 FlyBaseID:FBgn0050052 Length:212 Species:Drosophila melanogaster


Alignment Length:206 Identity:56/206 - (27%)
Similarity:88/206 - (42%) Gaps:24/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIILECSL-----ASFNCSAPPNFNNFDINTCCRTPELDMGDVPQKCHKY-----------VSG 59
            ||:::...|     |..:||..|:|.|  ..|||..|:....::.|||.|:           .||
  Fly     8 LLLVVGFCLNAAVSADVDCSKRPSFVN--PKTCCPMPDFVTAELKQKCIKFDMTPPPPPDGEASG 70

  Fly    60 -LKSANSKYPSYAHLCYPDCIYRETGAMVNGKIKVNRVKQYLEEHVHRRDQEIVSHIVQSFESCL 123
             .:|....:..:...|:..||:.|||...|.|:...::..||:| |.....::.:...|:|.:|.
  Fly    71 SFESKRRHHHPHPPPCFFSCIFNETGIYQNRKLDEAKLNAYLQE-VFEDSSDLQTTATQAFTTCA 134

  Fly   124 SNVKGHMKSLNIESYKVLPHG---CSPFAGIIYSCVNAETFLNCPQQMWKNEKPCNLAKQFAEQC 185
            :.|.....:|........|.|   |...||.:..||......|||..:..:.:.|...|:|..:|
  Fly   135 TKVADFEANLPPRPAPSPPPGFPMCPHDAGHLMGCVFRNMMKNCPDSIRNDSQQCTDMKEFFTKC 199

  Fly   186 NPLPHVPLPSS 196
            .| |..|.||:
  Fly   200 KP-PRGPPPSA 209



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BZKA
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006725
OrthoInspector 1 1.000 - - otm51238
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.