DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp50e and Obp46a

DIOPT Version :9

Sequence 1:NP_610959.2 Gene:Obp50e / 36600 FlyBaseID:FBgn0033931 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_610574.1 Gene:Obp46a / 36088 FlyBaseID:FBgn0033508 Length:198 Species:Drosophila melanogaster


Alignment Length:206 Identity:45/206 - (21%)
Similarity:82/206 - (39%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FGFLLIILECSLASFNCSAPP------NFNNFDI--NTCC----RTPELDMGDVPQKCHKYVSGL 60
            |.|||::|...:.  ..|.||      ..|:.|.  :.||    .:|:  ..|...:.|:.:.  
  Fly     6 FAFLLLLLTAFVT--GRSTPPALDEDCELNSVDTMHDFCCDLHDESPQ--FSDCQMEWHEKIP-- 64

  Fly    61 KSANSKYPSYAHLCYPDCIYRETGAMVNGK--IKVNRVKQYLE-EHVHRRDQEIVSHIVQSFESC 122
            ...:.:..:|. .|..:|.:..|..:...:  :.:|.||::|| :.|:..|   :..:..::..|
  Fly    65 YETDEEEQTYM-FCTAECSFNSTNFLGRDRRSLNLNEVKEHLESDLVNDAD---IKLLYDTYVKC 125

  Fly   123 LSNVKGHMKSLNIESYKVLPH-------------GCSPFAGIIYSCVNAETFLNCPQQMWKNEKP 174
                ..|..||       :||             ||.|:.|::..||..|..|:||.:.::....
  Fly   126 ----DKHALSL-------MPHKGVKQLSKRLSRLGCHPYPGLVLECVANEMILHCPTKRFRQTAQ 179

  Fly   175 CNLAKQFAEQC 185
            |...:...:||
  Fly   180 CEETRNHLKQC 190



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21066
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.