DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arc2 and Arc

DIOPT Version :9

Sequence 1:NP_610956.1 Gene:Arc2 / 36597 FlyBaseID:FBgn0033928 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_062234.2 Gene:Arc / 54323 RGDID:62037 Length:396 Species:Rattus norvegicus


Alignment Length:184 Identity:46/184 - (25%)
Similarity:80/184 - (43%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQFRIFIETIKSLGPIKEEPPSKGSFSNCTVRFSGQRDHDAVDEFINAVETYKEVEGISDKDALK 71
            ||..:..:..:|..|.::..||.|.   .|..|...|      ||::.:|.|....|.|::..|.
  Rat   185 EQESVGAQQYQSWVPGEDGQPSPGV---DTQIFEDPR------EFLSHLEEYLRQVGGSEEYWLS 240

  Fly    72 GLPLLFKSIAVVWWKGVRRDAKTWSDALQLLRDHFSPTKPSYQIYMEIFETKQSYDEVIDSFICK 136
            .:.......|..||:..:...|.|.:..:....:...|.....|..|: :..|...|.:|.|:.:
  Rat   241 QIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQREL-DLPQKQGEPLDQFLWR 304

  Fly   137 QRALLAKLPEGRHDEETELDFIYGLMQPKYRESIPRHEV-KTFRELLDRGRTVE 189
            :|.|...|.....:||. :.::.|.:|||::..: ||.: ||..:|:.||..|:
  Rat   305 KRDLYQTLYVDAEEEEI-IQYVVGTLQPKFKRFL-RHPLPKTLEQLIQRGMEVQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arc2NP_610956.1 None
ArcNP_062234.2 Interaction with SH3GL1 or SH3GL3. /evidence=ECO:0000269|PubMed:17088211 89..100
Interaction with DNM2. /evidence=ECO:0000269|PubMed:17088211 195..214 6/21 (29%)
Arc_C 278..360 CDD:407993 24/82 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.