DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arc2 and Arc1

DIOPT Version :9

Sequence 1:NP_610956.1 Gene:Arc2 / 36597 FlyBaseID:FBgn0033928 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_610955.1 Gene:Arc1 / 36595 FlyBaseID:FBgn0033926 Length:254 Species:Drosophila melanogaster


Alignment Length:199 Identity:106/199 - (53%)
Similarity:146/199 - (73%) Gaps:10/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTQMSDEQFRIFIETIK--SLGPI--------KEEPPSKGSFSNCTVRFSGQRDHDAVDEFINAV 55
            :|||::||.|..||.::  ::|..        .:....||:||.||..|.|.||||.|:|||..:
  Fly     4 LTQMTNEQLRELIEAVRAAAVGAAGSAAAAGGADASRGKGNFSACTHSFGGTRDHDVVEEFIGNI 68

  Fly    56 ETYKEVEGISDKDALKGLPLLFKSIAVVWWKGVRRDAKTWSDALQLLRDHFSPTKPSYQIYMEIF 120
            ||||:||||||::||||:.|||..:|..||:|||::|.||.:|:.|:|:|||||||:||||||.|
  Fly    69 ETYKDVEGISDENALKGISLLFYGMASTWWQGVRKEATTWKEAIALIREHFSPTKPAYQIYMEFF 133

  Fly   121 ETKQSYDEVIDSFICKQRALLAKLPEGRHDEETELDFIYGLMQPKYRESIPRHEVKTFRELLDRG 185
            :.||...:.||:|:.::|||||:||.||||||||||.::||:..|||:.|.||.|.||::||::|
  Fly   134 QNKQDDHDPIDTFVIQKRALLAQLPSGRHDEETELDLLFGLLNIKYRKHISRHSVHTFKDLLEQG 198

  Fly   186 RTVE 189
            |.:|
  Fly   199 RIIE 202



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EM8E
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.