DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arc1 and ARC

DIOPT Version :9

Sequence 1:NP_610955.1 Gene:Arc1 / 36595 FlyBaseID:FBgn0033926 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_056008.1 Gene:ARC / 23237 HGNCID:648 Length:396 Species:Homo sapiens


Alignment Length:223 Identity:55/223 - (24%)
Similarity:83/223 - (37%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AAGSAAAAGGADASR---------GKGNFSACTHSFGGTRDHDVVEEFIGNIETYKDVEGISDEN 81
            |||.......|:|.:         |:.:....|..|...|      ||:.::|.|....|.|:|.
Human   179 AAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPR------EFLSHLEEYLRQVGGSEEY 237

  Fly    82 ALKGISLLFYGMASTWWQGVRKEATTWKEAIALIREHFSPTKPAYQIYMEFFQNKQDDHDPIDTF 146
            .|..|.....|.|..||:..:.....|.|......::...|.....|..| ....|...:|:|.|
Human   238 WLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREAIQRE-LDLPQKQGEPLDQF 301

  Fly   147 VIQKRALLAQLPSGRHDEETELDLLFGLLNIKYRKHISRHSVHTFKDLLEQGRIIE--------- 202
            :.:||.|...|.... |||..:..:.|.|..|.::.:......|.:.|:::|..::         
Human   302 LWRKRDLYQTLYVDA-DEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEP 365

  Fly   203 ---HNNQEDE-EQLATAKNTR--GSKRT 224
               |...||| |.|..|.|:.  .|.||
Human   366 AGPHLPVEDEAETLTPAPNSESVASDRT 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arc1NP_610955.1 None
ARCNP_056008.1 Interaction with SH3GL1 or SH3GL3. /evidence=ECO:0000250|UniProtKB:Q63053 89..100
Interaction with DNM2. /evidence=ECO:0000250|UniProtKB:Q63053 195..214 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..396 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.