DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arc1 and Arc

DIOPT Version :9

Sequence 1:NP_610955.1 Gene:Arc1 / 36595 FlyBaseID:FBgn0033926 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001263613.1 Gene:Arc / 11838 MGIID:88067 Length:396 Species:Mus musculus


Alignment Length:212 Identity:49/212 - (23%)
Similarity:82/212 - (38%) Gaps:35/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RELIEAVRAAAVGAAGSAAAAGGADASRGKGNFSACTHSFGGTRDHDVVEEFIGNIETYKDVEGI 77
            :|.:||.:..:.|.......:.|.|           |..|...|      ||:.::|.|....|.
Mouse   186 QESVEAQQYQSWGPGEDGQPSPGVD-----------TQIFEDPR------EFLSHLEEYLRQVGG 233

  Fly    78 SDENALKGISLLFYGMASTWWQGVRKEATTWKEAIALIREHF------SPTKPAYQIYMEFFQNK 136
            |:|..|..|.....|.|..||:..:.....|.|    .::.|      :.::.|.|..:|.   .
Mouse   234 SEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVE----FKKEFLQYSEGTLSREAIQRELEL---P 291

  Fly   137 QDDHDPIDTFVIQKRALLAQLPSGRHDEETELDLLFGLLNIKYRKHISRHSVHTFKDLLEQGRII 201
            |...:|:|.|:.:||.|...|.....:||. :..:.|.|..|.::.:......|.:.|:::|..:
Mouse   292 QKQGEPLDQFLWRKRDLYQTLYVDAEEEEI-IQYVVGTLQPKLKRFLRHPLPKTLEQLIQRGMEV 355

  Fly   202 EHNNQEDEEQLATAKNT 218
                |:..||.|....|
Mouse   356 ----QDGLEQAAEPSGT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arc1NP_610955.1 None
ArcNP_001263613.1 Interaction with SH3GL1 or SH3GL3. /evidence=ECO:0000250|UniProtKB:Q63053 89..100
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..207 4/20 (20%)
Interaction with DNM2. /evidence=ECO:0000250|UniProtKB:Q63053 195..214 4/29 (14%)
Arc_C 278..360 CDD:375599 20/89 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..396 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.