DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and Snd1

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_073185.2 Gene:Snd1 / 64635 RGDID:631340 Length:909 Species:Rattus norvegicus


Alignment Length:226 Identity:49/226 - (21%)
Similarity:81/226 - (35%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 RPSFPCNANSKSLKVNDWSQKDRKQEP---------SKERNNQKYPKITTE-------NKQEKET 226
            :|.......:|..|...|:..:  ::|         .|||:....|...||       ..|:.||
  Rat   640 KPLLSAEEAAKQRKEKVWAHYE--EQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVET 702

  Fly   227 -EELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGE-----VKEKEDEAVVLAFDA 285
             .:|.:..||:..|::.....|    ..|.....||....|:.||     |::.|..|.|..| .
  Rat   703 GTQLEKLMENMRSDISSHPPVE----GAYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVF-Y 762

  Fly   286 VSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPR--DAVR 348
            :.....::|  .:|:..|:.|               ......:||.|.::....:..|:  ||..
  Rat   763 IDYGNREIL--PSTRLGALPP---------------AFSTRVLPAQATEYAFAFIQVPQDEDART 810

  Fly   349 SAFTLPARDIESIIELQQRIRVQLVSLVNPH 379
            .|.....|||::   .|..:.|:.:|...||
  Rat   811 DAVDSVVRDIQN---TQCLLNVEHLSASCPH 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 1/1 (100%)
Snd1NP_073185.2 SNc 20..165 CDD:214615
SNc 25..165 CDD:238102
SNc 192..327 CDD:214615
SNc 200..327 CDD:238102
Nuclear localization signal. /evidence=ECO:0000255 320..324
SNc 340..494 CDD:214615
SNc 349..495 CDD:238102
Nuclear localization signal. /evidence=ECO:0000255 387..391
SNc 524..659 CDD:214615 4/18 (22%)
SNc 532..659 CDD:238102 4/18 (22%)
TUDOR 676..798 CDD:278965 31/143 (22%)
TUDOR 727..783 CDD:197660 15/73 (21%)
SNc <843..894 CDD:294094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.