DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and RNF17

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_011533454.1 Gene:RNF17 / 56163 HGNCID:10060 Length:1699 Species:Homo sapiens


Alignment Length:610 Identity:114/610 - (18%)
Similarity:204/610 - (33%) Gaps:213/610 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SIPDTV-------TVTGHGQMAWITAVATAKSAHIQKLVR------CQKKSK---NRGSHKPKYC 106
            |.||.:       .|....::.:::.|......:|:|..:      .:||..   ||.||     
Human   425 SSPDVIIEEIIEDNVESSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVNEFCNRSSH----- 484

  Fly   107 YASEPSNLVFINES--VSKMKNRK--APFPTYQVP---RNLKLPVSYPNYNRL---------LYP 155
              .:||:::.:...  ||.:||..  ....|..:|   ||.:.|.| |  .||         ::.
Human   485 --LDPSDILELGARIFVSSIKNGMWCRGTITELIPIEGRNTRKPCS-P--TRLFVHEVALIQIFM 544

  Fly   156 VHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTEN 220
            |...:.:.:|.||...:.:|      |.::..:.:.:||.....||.||..              
Human   545 VDFGNSEVLIVTGVVDTHVR------PEHSAKQHIALNDLCLVLRKSEPYT-------------- 589

  Fly   221 KQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAFDA 285
                         |.|..|:.|......|| :|...|.:|            ..|:||.|     
Human   590 -------------EGLLKDIQPLAQPCSLK-DIVPQNSNE------------GWEEEAKV----- 623

  Fly   286 VSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDY---PRDAV 347
                  :.|.|...:..::|..          ..:||              ||.||.   |.:.:
Human   624 ------EFLKMVNNKAVSMKVF----------REEDG--------------VLIVDLQKPPPNKI 658

  Fly   348 RSAFTLPARDIESIIEL----QQRIR------------------------VQLVSLVNPHNFNFW 384
            .|...:..||....:||    .|.:|                        |.:..:.:|.:|   
Human   659 SSDMPVSLRDALVFMELAKFKSQSLRSHFEKNTTLHYHPPILPKEMTDVSVTVCHINSPGDF--- 720

  Fly   385 IYNDDFKDYEAQF--ANMQTFYESSESKNYTMPLFLITTDHLCVVRCTSG-WERAKVLGY----- 441
             |....:..:..|  ..::.||:|.:.:|  :.:.....|..||.:...| |.||||:..     
Human   721 -YLQLIEGLDILFLLKTIEEFYKSEDGEN--LEILCPVQDQACVAKFEDGIWYRAKVIELNHWES 782

  Fly   442 -------RSSNNKMTI----------------------------------EVELVDIGDIIRVSQ 465
                   |:...|:.|                                  ||:.||.|:..:::.
Human   783 CWKSCIDRTKQQKLIIQKPVNSSLMLTVCLSHAILIVKVQIKGLPGHQEVEVKYVDFGNTAKITI 847

  Fly   466 QNVKFLIKPFALLPRQCLAGRLAFITQCK-SPNWTAEVVNFFHDMILLRLLYAKV-EAIKNNTAY 528
            ::|:.:...|...|.:.:..:||:|...| :..|:.|....|.:....:.:...| :.:::|...
Human   848 KDVRKIKDEFLNAPEKAIKCKLAYIEPYKRTMQWSKEAKEKFEEKAQDKFMTCSVIKILEDNVLL 912

  Fly   529 LVLVDT--ESQGHTVNLNRSLIETG 551
            :.|.|:  ..:..|.::|..|::.|
Human   913 VELFDSLGAPEMTTTSINDQLVKEG 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 7/47 (15%)
TUDOR 379..488 CDD:278965 27/157 (17%)
RNF17XP_011533454.1 TUDOR 446..>553 CDD:278965 25/116 (22%)
TUDOR 702..870 CDD:278965 29/173 (17%)
TUDOR 758..852 CDD:119391 17/93 (18%)
TUDOR 990..1106 CDD:278965
TUDOR 1043..1089 CDD:119391
TUDOR 1253..1371 CDD:278965
TUDOR 1308..1353 CDD:119391
TUDOR 1486..1626 CDD:278965
TUDOR 1560..1607 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.