DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and tdrd1

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:XP_021335784.1 Gene:tdrd1 / 553522 ZFINID:ZDB-GENE-070803-1 Length:1201 Species:Danio rerio


Alignment Length:634 Identity:120/634 - (18%)
Similarity:184/634 - (29%) Gaps:250/634 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RKAPFPTYQVPRNLKLPVSYPNYNRLLYP--VHTPHIDQM-----------ISTGQ--------- 169
            |.|..|:...||. ..|..|.  .|||..  :..|.||.|           :|:.|         
Zfish    18 RPATGPSSLSPRG-PAPAIYE--ERLLASDVLDGPKIDTMRKDISQNCGDVLSSPQTAVSMMGQV 79

  Fly   170 --------QQSTLRTQRPSFPCNANSKSLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQEKET 226
                    .|..||..|....|.. |.:.:..||.......:||       .|::|:|..:|.:.
Zfish    80 VKLCNYCSHQGNLRCTRCKKTCYC-SVACQTQDWIAHRHVCKPS-------IPEVTSEKPKESKA 136

  Fly   227 EELAQAF-----ENLSVDVAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAF--- 283
            ...|...     :.:|||..|.        .||.       ||  ::.:|..|..|..||.|   
Zfish   137 VPYANGLGGTQAKEISVDAQPK--------RIYR-------RD--LHKKVVSKGSEIKVLFFRCS 184

  Fly   284 DAVSEDGFDLLSMTTTQQNAVKPLDPP---------EDCLH------------YASS-------- 319
            ..|.....|.|..|...|..|..|..|         |:.:.            |.||        
Zfish   185 SLVCYPSIDTLPHTKCLQGTVIDLRNPGMFSIHCQCEEMIESLKKITQQLQKTYCSSFAQEYKPE 249

  Fly   320 -----------------------------------DDGEDEN--------------AIPAYAVD- 334
                                               |.|.:||              |:|.:|:. 
Zfish   250 VGELCAVKFSLDQNWYRAEIQAVDVARKTAGVFYIDFGNEENVALDHIRPLSENIDAVPPFALQC 314

  Fly   335 ------------------------------HRVLDVDYPRD--AVRSAFTLPARDIES-IIELQQ 366
                                          ..|||:....|  ||.|..:...:.:.: :|:...
Zfish   315 CIAGVKPLTGSWTGECCIAVRQLIAGKSLTFTVLDIMNDGDLLAVDSLVSTLGKHVSTFLIDQSY 379

  Fly   367 RIRVQL-VSLVNPHNFNFWIYNDDFKDYEAQFANMQTF----YESSESKNYTMPL-------FLI 419
            .|:..: |.....|:.|..:        .|.|.|.:.|    .|:||::. ..||       |..
Zfish   380 AIKEDVPVKTQTEHSINSLL--------TASFENFKRFSGGKNENSEARP-PEPLTQGVGDSFTA 435

  Fly   420 TTDH-------LCV----------------VRCT-----------------------SGWERAKV 438
            ...|       ||.                |.|:                       :.|.||||
Zfish   436 VVTHLQSPSEILCQKLENASIIQQLQMNLRVHCSNTAASDDFRPAPGTVCCSLFSEDNQWYRAKV 500

  Fly   439 LGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVV 503
            |.|.|.:.   :.|..:|.|:...|....::.:.|....|..|.:...||.| :..:..|:.|.|
Zfish   501 LAYSSEDR---VCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGI-KSLTDTWSDEAV 561

  Fly   504 NFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHTVNLNRSLIETGW 552
            .....::..|.:..::...|:..|.:.::| ||.....::...|:..|:
Zfish   562 LMLKHLVCNRFIRVEILGKKDGRALVSMID-ESSDPQASVTELLVNMGF 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 32/165 (19%)
tdrd1XP_021335784.1 zf-MYND 83..119 CDD:307734 8/36 (22%)
TUDOR 210..318 CDD:306940 12/107 (11%)
TUDOR 429..548 CDD:306940 22/121 (18%)
TUDOR 652..770 CDD:306940
TUDOR 908..1020 CDD:306940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.