DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and Tudor-SN

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001261195.1 Gene:Tudor-SN / 38045 FlyBaseID:FBgn0035121 Length:926 Species:Drosophila melanogaster


Alignment Length:276 Identity:58/276 - (21%)
Similarity:99/276 - (35%) Gaps:79/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SKSLKVNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSV------------D 239
            :|:.|.|.|:  :..:|..||:.      :|.|.|::|...|....:||:.|            .
  Fly   664 AKAAKKNIWT--NYVEEVPKEKT------VTEEEKEDKVVAERKVNYENVIVTEITETLTFFAQS 720

  Fly   240 VAPTDHQEKLKCEIYEDNEDEFVRDPFIYGEVKEKEDEAVVLAF-----------DAVSEDGFDL 293
            |......|.|..:::.|    |..:|.|.|....|..:.|...|           :.|......:
  Fly   721 VESGSKLESLMSKLHAD----FQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNATV 781

  Fly   294 L--------SMTTTQQNAVKPLDPPED--CLHYA------SSDDGEDENAIPAYAVD---HRV-L 338
            |        ::.|.:..|:.|....|.  ...||      .:|:.:.|.|:.|::.|   |:| |
  Fly   782 LYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALRAFSEDVLNHKVQL 846

  Fly   339 DVDYPRDAVRSAFTLPARD------------IESIIELQQRIRVQLVSLVNPH----------NF 381
            :|:.......:..||  ||            .|.::..:||...:|..||:.:          :.
  Fly   847 NVELKVTGSPNLATL--RDPTTKVDFGKQLVAEGLVLAEQRGERKLKELVDQYKAAQEAARVAHL 909

  Fly   382 NFWIYNDDFKDYEAQF 397
            ..|.|.|..:|...:|
  Fly   910 AIWKYGDITQDDAPEF 925

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 5/29 (17%)
Tudor-SNNP_001261195.1 SNc 23..166 CDD:214615
SNc 195..333 CDD:214615
SNc 346..504 CDD:320778
SNc 538..672 CDD:214615 3/7 (43%)
TUDOR 697..817 CDD:306940 23/123 (19%)
SNc 767..914 CDD:320778 28/148 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.