DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and krimp

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_611103.2 Gene:krimp / 36804 FlyBaseID:FBgn0034098 Length:746 Species:Drosophila melanogaster


Alignment Length:336 Identity:71/336 - (21%)
Similarity:117/336 - (34%) Gaps:97/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 DRKQEPSKERNNQKYPKITTE------NKQEKETEELAQAFENLSVDVAPTDHQE-------KLK 250
            ||...|:| .|..|||...||      |:.::.|.:..:|.    :...|.|.|.       ||.
  Fly   466 DRLSRPTK-TNTTKYPAGITEDDMAMLNEIDESTSDPLKAV----LGFRPKDEQRICRHYDPKLN 525

  Fly   251 -CEIYEDNEDEFVRDPFI-YGEVKEKEDEAVVLAFDAVSEDGFD---------LLSMTTTQQNAV 304
             |  ::.|...|..:||. .|..|:.|     || .|:.|..||         ::.:..|..|. 
  Fly   526 GC--FKGNNCRFAHEPFAPNGATKDVE-----LA-RALPETIFDTTVHFEIGSIVGILITFING- 581

  Fly   305 KPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPRDAVRSAFTLPARDIESIIELQQRIR 369
                |.|   .|....||.     |....|.:    |.|.:  :..|....|.::.::.|.....
  Fly   582 ----PTE---VYGQFLDGS-----PPLVWDKK----DVPEN--KRTFKSKPRLLDIVLALYSDGC 628

  Fly   370 VQLVSLVNPHNFNFWIYNDDFKDYE-------AQFANMQTFYESS----------ESKNYTMPLF 417
            .....:::.....:.|:..|:.:.|       |...|:.:|....          .|||.|    
  Fly   629 FYRAQIIDEFPSEYMIFYVDYGNTEFVPLSCLAPCENVDSFKPHRVFSFHIEGIVRSKNLT---- 689

  Fly   418 LITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIE-VELVDIGDIIRVSQQNVKFLIKPFALLPRQ 481
                 |...:.|.. :.::|:|     |.:|.:. |:.:..|.:||        .:..:..:|.|
  Fly   690 -----HQKTIECIE-YLKSKLL-----NTEMNVHLVQRLPDGFLIR--------FLDDWKYIPEQ 735

  Fly   482 CLAGRLAFITQ 492
            .|....|.::|
  Fly   736 LLQRNYAQVSQ 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 23/126 (18%)
krimpNP_611103.2 TUDOR 568..679 CDD:278965 20/129 (16%)
TUDOR 618..662 CDD:119391 4/43 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.