DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and Tdrd6

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001178512.1 Gene:Tdrd6 / 316254 RGDID:1305956 Length:2136 Species:Rattus norvegicus


Alignment Length:609 Identity:117/609 - (19%)
Similarity:204/609 - (33%) Gaps:188/609 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLPYSKLGFKDAESFLRSIPDTVTVTGHG- 69
            ||.|.:.|..||..|         |::.|.:..|       ||...|....|:.|.    ..|. 
  Rat   193 ELGLARHVPDSLFCS---------LLKRYLTAAG-------LGSSGAPVLPRAAPK----QEHPG 237

  Fly    70 --------QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKN 126
                    |:.....|...:..|..: :.||.:|.::..|:              ::||::::  
  Rat   238 LDYFYPQLQLGVTEPVVVTQVCHPHR-IHCQLRSLSQEIHR--------------LSESMAQV-- 285

  Fly   127 RKAPFPTYQVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLK 191
                   |:.|..                  |...|...:|.:::.. ...:|..||        
  Rat   286 -------YRAPTG------------------TEDEDSGSATWEEREE-SPDKPGSPC-------- 316

  Fly   192 VNDWSQKDRKQEPSKERNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYED 256
                        .|...:.|.|..:..|..:.:...::      |.||..   .:|.:.|.....
  Rat   317 ------------ASCGLDGQWYRALLLETFRPQRCAQV------LHVDYG---RKELVSCSSLRY 360

  Fly   257 NEDEFVRDPFI--------------------YGEVKEKEDEAVVL------------AFDAV--- 286
            ...|:.|.|.:                    .|::|     |::|            :|:.:   
  Rat   361 LLPEYFRMPVVTYPCALYGLWDCGRGWSRSQVGDLK-----ALILGQAVNAKIEFYCSFEHMYYV 420

  Fly   287 ---SEDGFDLLSMTTTQQNAVKPLDPPEDCL--HYASSDDGEDENAIPAYAVDHRVLDVDYPRDA 346
               .|||.:|.|....|          ..||  .:..|...|:|.              |...|.
  Rat   421 TLYGEDGINLNSAFGVQ----------SCCLADRFLQSQGIEEEE--------------DEDEDE 461

  Fly   347 VRSAF--TLPARDIESIIELQ--QRIRVQL-------VSLVNPHNFNFWIYNDDFKDYEAQFANM 400
            :.:||  ..||.::|..:.|.  :.||:::       |..|...: .|||.....|:..::....
  Rat   462 MEAAFQSQSPAEEMEEEVSLPSLRSIRLKMNTFYDAQVEFVKSPS-EFWIRLRKHKNTFSKLTKR 525

  Fly   401 QTFYESSESKNYTMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQ 465
            ...:.||.||...:.|.....|..||....:|:.||.|....|.    :::|.|||.|:...|..
  Rat   526 MCSFYSSASKLDGVILKPEPDDLCCVKWKENGYYRAMVTRLDSK----SVDVFLVDRGNSENVDW 586

  Fly   466 QNVKFLIKPFALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLV 530
            .:|:.|:..|..||...|...||.|... ...|:.|.::||...:|.:.|...: ..|.:..|::
  Rat   587 CDVRMLLPQFRQLPILALKCTLADIWPL-GKTWSQEAISFFKKTVLHKELVVHI-LDKQDRQYVI 649

  Fly   531 LVDTESQGHTVNLNRSLIETGWVR 554
            .:..||:....|:::.:.:.|:.:
  Rat   650 EILDESRTGEENISKVIAQAGYAK 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 19/94 (20%)
TUDOR 379..488 CDD:278965 29/108 (27%)
Tdrd6NP_001178512.1 TUDOR 10..133 CDD:278965
TUDOR 245..379 CDD:278965 29/205 (14%)
TUDOR 313..359 CDD:119391 11/74 (15%)
TUDOR 489..610 CDD:278965 32/125 (26%)
TUDOR 547..591 CDD:119391 15/47 (32%)
TUDOR 775..891 CDD:278965
TUDOR 827..870 CDD:119391
TUDOR 988..1107 CDD:278965
TUDOR 1043..1085 CDD:119391
TUDOR 1310..1429 CDD:278965
TUDOR 1363..1407 CDD:119391
TUDOR 1523..1645 CDD:278965
TUDOR 1578..>1616 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.