DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and CG15930

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_572214.2 Gene:CG15930 / 31446 FlyBaseID:FBgn0029754 Length:513 Species:Drosophila melanogaster


Alignment Length:435 Identity:90/435 - (20%)
Similarity:173/435 - (39%) Gaps:77/435 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQ----QQSTLRTQRPSFPCNANSKSLKVNDWS 196
            ||.:|:.|.:....|::|     ..:..|:...:    ::.|..:::|     |||:. ::|...
  Fly    32 VPLDLRCPSAKMRNNKVL-----ADLSDMLKVVEDIALEEKTTDSKKP-----ANSEQ-QINGTI 85

  Fly   197 Q--KDRKQEPSKER----NNQKYPKI-----------TTENKQEKETEEL--AQAFENLSVD-VA 241
            :  .|.:|..:|.|    ::....|:           ||::|...||::.  .:.|:.:..: |.
  Fly    86 ELALDLRQPNAKIRLVISDSSDLQKVFEKAHIALELKTTDSKPTAETDDQHHVRIFDKMLCNIVV 150

  Fly   242 PTD------HQEKLKCEIYEDNEDEFVRDP--------------FIYGEVKEKEDEAVV---LAF 283
            |.|      :.:.|:..:...:|.:.:.:|              |:....:..|..|.|   ||.
  Fly   151 PPDVADVQVNGKPLEQLLATVSERQAMNNPGPMKMHELHTGNADFMNSNSQVAEAAASVETLLAS 215

  Fly   284 DAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPRDAVR 348
            .:.::...|.|...||....||.|.|        |..|..|...:...|:.:.:     |.|||.
  Fly   216 TSDNDSDSDGLESKTTDGYIVKELIP--------SFSDFPDIGDVSLCALMYGL-----PMDAVG 267

  Fly   349 SAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDF-KDYEAQFA-NMQTFYESSESKN 411
            ..:.||.:.|:.|.:......:.:..:.:|..|.|.|....: |:..|:.. ::..||..:...:
  Fly   268 MHWKLPPQRIQDICKEDSIFPIIMSCVFSPCEFWFHIVPPQYAKNPVAEMTIDLNWFYRHTTISS 332

  Fly   412 Y--TMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKP 474
            |  .:|.:.....::|......||.||.|| ..:..:...:.:|.||....:.::..:::||...
  Fly   333 YRAELPSYFYKEGYICAAYSECGWRRAMVL-VTAPLDAQCVNIEYVDHALSVTLAPNHLRFLPLS 396

  Fly   475 FALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKV 519
            ||..|.....|:::.:....: .|....:..|..|...|:|||.|
  Fly   397 FARTPPLVFRGKMSHVRPLAN-GWPKNGITAFQRMTFNRVLYAHV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 25/112 (22%)
CG15930NP_572214.2 TUDOR 281..411 CDD:278965 26/130 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.