DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tej and TDRD6

DIOPT Version :9

Sequence 1:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster
Sequence 2:NP_001010870.1 Gene:TDRD6 / 221400 HGNCID:21339 Length:2096 Species:Homo sapiens


Alignment Length:599 Identity:116/599 - (19%)
Similarity:210/599 - (35%) Gaps:174/599 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ELSLVKKVVHSLVVSSPGKLTVEQLMRDYRSEEGCTLP-YSKLGFKDAESFLRSIPDTVTVTGHG 69
            ||.|.::|..||..|     .:|:.:....:..|..:| .|::..|..:..|......:      
Human   193 ELGLARRVPDSLFRS-----LLERYLTAATASVGSGVPVLSRVPLKQKQPGLDYFYPQL------ 246

  Fly    70 QMAWITAVATAKSAHIQKLVRCQKKSKNRGSHKPKYCYASEPSNLVFINESVSKMKNRKAPFPTY 134
            |:....||...:..|..: :.||.:|.::..|:              ::||::            
Human   247 QLGVTEAVVITQVCHPHR-IHCQLRSVSQEIHR--------------LSESMA------------ 284

  Fly   135 QVPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQQQSTLRTQRPSFPCNANSKSLKVNDWSQKD 199
            ||.|.                        ...||.:.||..|                  |  ::
Human   285 QVYRG------------------------STGTGDENSTSAT------------------W--EE 305

  Fly   200 RKQEPSKE--------RNNQKYPKITTENKQEKETEELAQAFENLSVDVAPTDHQEKLKCEIYED 256
            |::.|.|.        .:...|..:..|..:.:...::      |.||..   .:|.:.|.....
Human   306 REESPDKPGSPCASCGLDGHWYRALLLETFRPQRCAQV------LHVDYG---RKELVSCSSLRY 361

  Fly   257 NEDEFVRDPFI--------------------YGEVKE----KEDEAVV---LAFDAV------SE 288
            ...|:.|.|.:                    .|::|.    |...|.:   .:|:.|      .|
Human   362 LLPEYFRMPVVTYPCALYGLWDGGRGWSRSQVGDLKTLILGKAVNAKIEFYCSFEHVYYVSLYGE 426

  Fly   289 DGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENA---IPAYAVDHRVLDVDYPRDAVRSA 350
            ||.:|..:...|...:     .:..|...::::.|.|.:   .||..||..:             
Human   427 DGINLNRVFGVQSCCL-----ADRVLQSQATEEEEPETSQSQSPAEEVDEEI------------- 473

  Fly   351 FTLPARDIESI-IELQQRIRVQLVSLVNPHNFNFWIYNDDFKDYEAQFANMQT----FYESSESK 410
             :|||  :.|| :::......|:..:.||.  .|||   ..:.:...|:.:..    || ||.||
Human   474 -SLPA--LRSIRLKMNAFYDAQVEFVKNPS--EFWI---RLRKHNVTFSKLMRRMCGFY-SSASK 529

  Fly   411 NYTMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKPF 475
            ...:.|.....|..||....:|:.||.|    :..:..:::|.|||.|:...|...:|:.|:..|
Human   530 LDGVVLKPEPDDLCCVKWKENGYYRAIV----TKLDDKSVDVFLVDRGNSENVDWYDVRMLLPQF 590

  Fly   476 ALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKVEAIKNNTAYLVLVDTESQGHT 540
            ..||...:...||.|... ...|:.|.|:||...:|.:.|...: ..|.:..|::.:..||:...
Human   591 RQLPILAVKCTLADIWPL-GKTWSQEAVSFFKKTVLHKELVIHI-LDKQDHQYVIEILDESRTGE 653

  Fly   541 VNLNRSLIETGWVR 554
            .|:::.:.:.|:.:
Human   654 ENISKVIAQAGYAK 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586 17/86 (20%)
TUDOR 379..488 CDD:278965 29/112 (26%)
TDRD6NP_001010870.1 TUDOR <69..133 CDD:278965
TUDOR 246..380 CDD:278965 32/219 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..316 10/72 (14%)
TUDOR 314..360 CDD:119391 7/54 (13%)
TUDOR 483..604 CDD:278965 33/130 (25%)
TUDOR 541..585 CDD:119391 14/47 (30%)
TUDOR 770..886 CDD:278965
TUDOR 821..866 CDD:119391
TUDOR 982..1102 CDD:278965
TUDOR 1037..1080 CDD:119391
TUDOR 1301..1422 CDD:278965
TUDOR 1356..1401 CDD:119391
TUDOR 1516..1638 CDD:278965
TUDOR 1571..>1609 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.