DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ih and KT5

DIOPT Version :9

Sequence 1:NP_001033948.1 Gene:Ih / 36589 FlyBaseID:FBgn0263397 Length:1327 Species:Drosophila melanogaster
Sequence 2:NP_194976.1 Gene:KT5 / 829385 AraportID:AT4G32500 Length:880 Species:Arabidopsis thaliana


Alignment Length:607 Identity:123/607 - (20%)
Similarity:237/607 - (39%) Gaps:126/607 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 KTSGH-----WVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTI-- 796
            ::|.|     :::.|.......||..:::|::......|....|    |.|.....:.|.:.:  
plant    59 RSSRHIKLRCFIVSPFDPRYRAWDWFLVILVLYTAWASPFEFGF----LQTPRAPLSILDNVVNG 119

  Fly   797 -FLIDIVVNFRTGIMQQDNAEQVIL-DPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQIM--KL 857
             |.:|||:.|....:  |.|..::: |||.||..|..||...|::|::|.:    :|..::  .:
plant   120 FFAVDIVLTFFVAFL--DKATYLLVDDPKRIAWRYTSTWLIFDVVSTVPYE----LFGSLLHNTI 178

  Fly   858 QDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYILQNLQKKSADRRGRMNR 922
            |.:.                   :.|::||.||.|:.:..::.|                     
plant   179 QGYG-------------------IFSMLRLWRLHRVSKCFARLE--------------------- 203

  Fly   923 KDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQE 987
            ||:    |.|..         ::|...|:.:.|.:.|...|..:.:......||.::::   |.|
plant   204 KDR----KYNYF---------WIRCTKLLLVSLFVVHCGACFCYSIAAHYPDPSMTFMA---LAE 252

  Fly   988 SYW-----LEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQ 1047
            :.|     |.:|..|::.:::.....|||.....:..:....:..||......|..:|:.|||:.
plant   253 ANWKQKSLLIRYVTAMYWSITTFSTTGYGDIHGNNAEERAFILFYMIFNLGLLAYIIGNMTNLVV 317

  Fly  1048 SLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQ--GKFFDEELILGELSEKLREDV 1110
            .:.|..|.:|:.::....:.....||..:::::..:...||:  .:...::.|:..|.:.:|..:
plant   318 HVTSRTRNFRDTIQAASAFAQRNNLPLGLQEQMVAHLSLRYRTDSEGLQQQEIIDSLPKAIRSSI 382

  Fly  1111 INYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIV-MA 1174
            .:|....:|.....|....::.:..:|:::|.|.|.|.:.:|......:..|.:..|.|||: ..
plant   383 SHYLFYEVVDKTYLFHGISNDLLFQLVSEMKAEYFPPKEDVILRNEAPSDFYIMVTGAVDIIARV 447

  Fly  1175 NG--EVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVA 1237
            ||  :|......|..|||:.:|....::.:||.:....|..|:...|             :..|.
plant   448 NGVDQVVGEAQTGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTAF-------------LNLVQ 499

  Fly  1238 AERLNKIGKNPNIM-----HQKDEQLSNPESNTITAVVNALAAEAD----------DCKDDDMDL 1287
            |    .:|....||     |.||.  ::|....|.|....:.|:..          ..:.||:.|
plant   500 A----NVGDGAIIMNNLLQHLKDS--TDPVMKGILAETELMLAQGKMDLPLSLCFAAARGDDLLL 558

  Fly  1288 KENLLHGSESSIAEPVQTIREG 1309
            .:.|..||     .|.:|.:.|
plant   559 HQLLKRGS-----NPNETDKNG 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IhNP_001033948.1 Ion_trans_N 709..751 CDD:285597 3/16 (19%)
Ion_trans 771..1054 CDD:278921 60/293 (20%)
Crp 1118..>1241 CDD:223736 28/125 (22%)
CAP_ED 1124..1233 CDD:237999 25/111 (23%)
KT5NP_194976.1 PLN03192 34..877 CDD:215625 123/607 (20%)
ANK repeat 546..572 CDD:293786 7/30 (23%)
ANK repeat 574..605 CDD:293786 1/2 (50%)
ANK repeat 607..669 CDD:293786
ANK repeat 671..702 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm987
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.