DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ih and Kcnh6

DIOPT Version :9

Sequence 1:NP_001033948.1 Gene:Ih / 36589 FlyBaseID:FBgn0263397 Length:1327 Species:Drosophila melanogaster
Sequence 2:XP_006247617.1 Gene:Kcnh6 / 116745 RGDID:620304 Length:971 Species:Rattus norvegicus


Alignment Length:542 Identity:137/542 - (25%)
Similarity:228/542 - (42%) Gaps:125/542 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   735 RIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFF---NDDLSTRWIAFNC----- 791
            ||.:.|..|:     |.|:..||..:|||::...:..|.:.:|.   .|:.......:.|     
  Rat   243 RIHRGTILHY-----SPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESQRGTCGYTCSPLTV 302

  Fly   792 ---LSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQ 853
               :.|.:|::|||:||||..:..:  ::|:..|:.||.||.:.||.:|::::||.|  .|||  
  Rat   303 VDLIVDIMFVVDIVINFRTTYVNTN--DEVVSHPRRIAVHYFKGWFLIDMVAAIPFD--LLIF-- 361

  Fly   854 IMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYILQNLQKKSADRRG 918
                :..||....|     :.:|:.|:||.|||:.|  :|.||......|               
  Rat   362 ----RTGSDETTTL-----IGLLKTARLLRLVRVAR--KLDRYSEYGAAV--------------- 400

  Fly   919 RMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSIN 983
                                        :|.|:|...||.||..|:              |.:|.
  Rat   401 ----------------------------LFLLMCTFALIAHWLACI--------------WYAIG 423

  Fly   984 ELQESY------WL-----------------------EQYSWALFKAMSHMLCIGYGRFPPQSLT 1019
            .::..|      ||                       ::|..||:...|.:..:|:|...|.:.:
  Rat   424 NVERPYLEPKIGWLDSLGAQLGKQYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNS 488

  Fly  1020 DMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYF 1084
            :...::..|:.|:..||...|:.:.:||.|.|...:|..::.:|:|::.:.::|..:|||:.|||
  Rat   489 EKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYF 553

  Fly  1085 EHRYQ-GKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPG 1148
            :|.:. ....|...:|....|.|:.|:..:..|:|:...|.|..|....:..:..|.|.....||
  Rat   554 QHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPG 618

  Fly  1149 DIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNAR---RVASVRAETYCN 1210
            |.::..|.:.:.:|||..|.::| :.:..|...|.....|||...| :||   ..|.|||.|||:
  Rat   619 DTLVHLGDVLSTLYFISRGSIEI-LRDDVVVAILGKNDIFGEPASL-HARPGKSSADVRALTYCD 681

  Fly  1211 LFSLSVDHFNCVLDQYPLMRKT 1232
            |..:.......|||.||....|
  Rat   682 LHKIHRADLLEVLDMYPAFADT 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IhNP_001033948.1 Ion_trans_N 709..751 CDD:285597 4/15 (27%)
Ion_trans 771..1054 CDD:278921 72/322 (22%)
Crp 1118..>1241 CDD:223736 37/118 (31%)
CAP_ED 1124..1233 CDD:237999 35/112 (31%)
Kcnh6XP_006247617.1 PAS_9 29..132 CDD:290162
PAS 41..132 CDD:238075
Ion_trans 296..520 CDD:278921 68/297 (23%)
Ion_trans_2 <463..517 CDD:285168 13/53 (25%)
Crp 588..>701 CDD:223736 36/114 (32%)
CAP_ED 594..705 CDD:237999 35/112 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.