DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ih and hcn5

DIOPT Version :9

Sequence 1:NP_001033948.1 Gene:Ih / 36589 FlyBaseID:FBgn0263397 Length:1327 Species:Drosophila melanogaster
Sequence 2:XP_017213269.1 Gene:hcn5 / 101884258 ZFINID:ZDB-GENE-081105-169 Length:305 Species:Danio rerio


Alignment Length:297 Identity:119/297 - (40%)
Similarity:173/297 - (58%) Gaps:36/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 PTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFN 779
            |..||.::.::||..|:.||.||||..|..||||.|..|.|:.:||:.:...|||.:|:.|:|.:
Zfish    23 PQLNRRSLFVYGSEVAVEKECIRQKEGGVLVIHPFSRLRSYYIMCMVAITFLNLIGIPMEIAFLD 87

  Fly   780 DDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPL 844
            .:....|..||..|||:||||:.||||.||:.:| .|:.|||.|.|...||::||..||:::.|:
Zfish    88 GNSGVGWEGFNVFSDTLFLIDVGVNFRMGIIPED-CERAILDLKSIRHRYLKSWFIPDLVAAFPV 151

  Fly   845 DYIFLIFNQIMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYILQNL 909
            .||.||.:    ||..||| ....|.:.:|||...:::|||||||:|||||:.::.|.|      
Zfish   152 GYILLIAD----LQYHSDS-PSSKASKMMRILMFVRIISLVRLLRVSRLVRFFNEVERV------ 205

  Fly   910 QKKSADRRGRMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGF 974
                               :.:|     |.:..||::|.:|..|:.|:.||:||:|:.||||:.|
Zfish   206 -------------------SNAN-----LEVVRVFLKILSLFMMIFLLCHWNGCIQYFVPMLEEF 246

  Fly   975 PSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYG 1011
            ||:.||....|..:...|:||:.:|:|:|||..|.||
Zfish   247 PSDCWVRRENLMNASVGEKYSFGVFRALSHMTAISYG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IhNP_001033948.1 Ion_trans_N 709..751 CDD:285597 17/35 (49%)
Ion_trans 771..1054 CDD:278921 94/241 (39%)
Crp 1118..>1241 CDD:223736
CAP_ED 1124..1233 CDD:237999
hcn5XP_017213269.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000897
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45689
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.